DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and CG7691

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:366 Identity:83/366 - (22%)
Similarity:128/366 - (34%) Gaps:103/366 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RSMFSDRYNNRRRNFYERYEAARIIHPSLPECQRPVEPTEVKHPNNPVNRRPVSYRQMANQSRRQ 66
            ||..|||||.::..||:|||....:.|:||...||......:....|..:..|.:.....||.  
  Fly     6 RSFLSDRYNGKQERFYDRYEDFCQVIPNLPPMPRPKTNHHSRVATKPEPKTNVKFTYCFGQSE-- 68

  Fly    67 LENDSWLSSDRLPMMVRHEIETRNKKQLMSKYNAETATHVFSHNGGPRRGRPPSAATAARMASEF 131
             .:..|...|.:|::||.|:|.|...||||.... |.:.:.||                      
  Fly    69 -PSGDWRQGDDIPIVVRREMEERLGIQLMSVLPI-TESSLLSH---------------------- 109

  Fly   132 ARQVGGISQSPTIEDEGKSGEQSVMQPKSKKANKMPDKVADKLATKSEPKSEESNVPVKIKVEGV 196
                       ||.:                 .|||.:..|.:     ||:...     |||..:
  Fly   110 -----------TIWE-----------------LKMPGESFDSI-----PKTRNG-----IKVGII 136

  Fly   197 EHNAEGSQSDSMVNTNQGFTTNRNFIPILSSFPNPYRNMDVTWTEQFNALSNQYYNHIMNSISSL 261
            ...||..|:.:.:. .:|        |||::...|...:::...:|......:....:......:
  Fly   137 TVTAESKQTRTKLK-RKG--------PILANVTVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECI 192

  Fly   262 S---------QIQPLNSTPSANPPIFGANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRE 317
            .         .:.....|.:...|                 |.||...|::.|..|..:..|||.
  Fly   193 DCDKKFDHSWMLTAHTRTHTGEKP-----------------FVCPDGSCRKAFSDRSNLRSHQRT 240

  Fly   318 TGHHNWPHNCSKCGQVFRTSGFMRMHSVNACARNL----HK 354
            .|||.|.|.|.:||:.|....::..||::||.:.|    ||
  Fly   241 MGHHEWQHQCGQCGKYFSQFSYLNRHSLDACRKYLLSVMHK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 22/99 (22%)
C2H2 Zn finger 191..211 CDD:275368 0/19 (0%)
zf-H2C2_2 203..229 CDD:290200 6/42 (14%)
C2H2 Zn finger 219..244 CDD:275368 9/24 (38%)
C2H2 Zn finger 250..266 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016907
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.