DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and CG12605

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster


Alignment Length:375 Identity:70/375 - (18%)
Similarity:134/375 - (35%) Gaps:80/375 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ERYEAA-------RIIHPSLPEC--------QRPVEPTEVKH-PNNPVNRRPVSYRQMANQSRRQ 66
            |..|||       :.:.|.:|.|        |..:...|::. .|:..:|.|.|..:....|...
  Fly   243 EETEAAHDLLSLSQSLPPLIPPCVVTIMKQEQEQLRSPEIQEISNSASSRSPQSTIRFIGSSSYD 307

  Fly    67 LENDSWLSSDRLPMMVRHEIETRNKKQLMSKYNAETATHV------FSHNGGPRRGRP-----PS 120
            |...|              .|..|....::..|::.::.|      .|.:|..:.|:|     ..
  Fly   308 LMGGS--------------SEGANNCSPLTPPNSDHSSDVDIDMSSSSESGLQQWGKPNPQQNQQ 358

  Fly   121 AATAARMASEFARQVGGISQSPTIEDEGKSGEQSVMQPKSKKANKMPDKVADKLATKSEPKSEES 185
            .|:|.:|.   ...:.|.:::.......|...|..|||:.|.|.       ...::...|.||  
  Fly   359 RASALKMC---LNMLDGRTKASKAAAVTKQDRQEPMQPRPKSAQ-------SNASSGGGPPSE-- 411

  Fly   186 NVPVKIKVEGVEHNAEGSQSDSMVNTNQG----------FTTNRNFIPILSSFPNPYRNMDVTWT 240
              |.:.....:.|::.|: .::.....:|          :.|:.|    ||.....:|::|....
  Fly   412 --PPENPAASLGHSSSGN-GENYAKRKRGCYKCCECGKQYATSSN----LSRHKQTHRSLDSQSA 469

  Fly   241 EQFNALSNQYYNHIMNSISSLSQIQPLNSTPSANPPIFGANPMVMGR---HPPFSVFSCPLDYCK 302
            ::.|.....|.:  |.:::.......|:.:......:|....::.|.   |.....::|.  :|.
  Fly   470 KKCNTCGKAYVS--MPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACV--HCG 530

  Fly   303 ENFDSRRAMYKH-QRETGHHNWPHNCSKCGQVFRTSGFMRMHSVNACARN 351
            :.|..|..:..| |..:|..|:  .|.:|.:.|....::..|..:||.|:
  Fly   531 KAFADRSNLRAHMQTHSGDKNF--KCHRCNKTFALKSYLNKHLESACLRD 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 4/25 (16%)
C2H2 Zn finger 441..461 CDD:275370 4/23 (17%)
C2H2 Zn finger 472..492 CDD:275368 3/21 (14%)
COG5048 492..>570 CDD:227381 15/81 (19%)
zf-C2H2 496..518 CDD:278523 2/21 (10%)
C2H2 Zn finger 498..518 CDD:275368 2/19 (11%)
zf-H2C2_2 511..534 CDD:290200 4/24 (17%)
zf-C2H2 524..546 CDD:278523 6/23 (26%)
C2H2 Zn finger 526..546 CDD:275368 6/21 (29%)
zf-H2C2_2 538..562 CDD:290200 6/25 (24%)
C2H2 Zn finger 554..571 CDD:275368 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.