DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and sna

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:282 Identity:57/282 - (20%)
Similarity:108/282 - (38%) Gaps:62/282 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 PPSAATAARMASEFAR-QVGGISQSPTIEDEGKSGEQSVMQPKSKK-----ANKMPDKVADKLAT 176
            |.:.|.|....|:||: |...:|.....::|    .|...||:.|:     .:|.|::.:...:.
  Fly    23 PQTEALALTKDSQFAQDQPQDLSLKRGRDEE----TQDYQQPEPKRDYVLNLSKTPERNSSSSSN 83

  Fly   177 K---SEPKSEESNVPVKIKVEGVEHNAEG--SQSDSMVNTNQ-GFTTNRNFIPI----------L 225
            .   |.|...:..:|.:|.:.|:.....|  :.:.:.:|..| .|.......||          |
  Fly    84 SCLLSPPVEAQDYLPTEIHMRGLTAGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHL 148

  Fly   226 SSFPNPYRNM----DVTWTEQFNALSNQYYN----------------------HIMNSISSLSQI 264
            ::||:|..:|    .|...:|....|:...:                      |:.:...|.|..
  Fly   149 AAFPSPASSMASPQSVYSYQQMTPPSSPGSDLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSG 213

  Fly   265 QPLNSTP--SANPPIFGANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQR------ETGHH 321
            ..::|:.  |..|.:..::..|...|.....|.|  |.|::.:.:...:.||::      |....
  Fly   214 ASVSSSSGYSYTPAMSASSASVAANHAKNYRFKC--DECQKMYSTSMGLSKHRQFHCPAAECNQE 276

  Fly   322 NWPHNCSKCGQVFRTSGFMRMH 343
            ...|:|.:||:::.|.|.::||
  Fly   277 KKTHSCEECGKLYTTIGALKMH 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368
zf-H2C2_2 321..344 CDD:290200
zf-C2H2 334..356 CDD:278523
C2H2 Zn finger 336..356 CDD:275368
zf-H2C2_2 348..373 CDD:290200
C2H2 Zn finger 364..380 CDD:275368
C2H2 Zn finger 247..267 CDD:275368 5/21 (24%)
C2H2 Zn finger 282..302 CDD:275368 7/17 (41%)
zf-C2H2 306..328 CDD:278523
COG5048 307..>356 CDD:227381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.