DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and esg

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_476600.1 Gene:esg / 34903 FlyBaseID:FBgn0001981 Length:470 Species:Drosophila melanogaster


Alignment Length:417 Identity:80/417 - (19%)
Similarity:142/417 - (34%) Gaps:116/417 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EVKHPNNPVNRRPVSYRQMANQSRRQLENDSWLSSDRLPMMVRHEIETRNKKQLMSKYNAETATH 105
            |..:...|:.:|||:|:..|.|:.....|:.      ..:.|:       |.:::.:..:|...:
  Fly    10 EKNYSKCPLKKRPVNYQFEAPQNHSNTPNEP------QDLCVK-------KMEILEENPSEELIN 61

  Fly   106 V----------FSH-----------------NGGPRRGRPPSAATAARMASEFARQV-------- 135
            |          ..|                 :..|.:.:..:.|.||.:|:..|..|        
  Fly    62 VSDCCEDEGVDVDHTDDEHIEEEDEDVDVDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYP 126

  Fly   136 ----GGISQSP-------TIEDEGKS-----GEQSVMQPKSKKANKMPDKVADKLATKSEP---- 180
                .....||       ||..:|..     |:  ::.|.|.         :|.|.:.|.|    
  Fly   127 KYPWNNFHMSPYTAEFYRTINQQGHQILPLRGD--LIAPSSP---------SDSLGSLSPPPHHY 180

  Fly   181 -KSEESNVPVKIKVEGVEHNAEGSQSDSMVNTNQ--------GFT-TNRNFIPILSSF-PNPYRN 234
             ....|:|...::.| :.|...|.:....:...|        |:| |:.:..||..:: .|.|.:
  Fly   181 LHGRASSVSPPMRSE-IIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYS 244

  Fly   235 MDVTWTEQF------NALSNQYYNHIMNSISSLSQIQPLNSTPSANPPIF-GANPMVMGRHPPFS 292
            |.....|..      ..||.::.|..:|..:|....|....|...:|... .|:.......||  
  Fly   245 MRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPP-- 307

  Fly   293 VFSCPLDYCKENFDSRRAMYKHQR------ETGHHNWPHNCSKCGQVFRTSGFMRMH---SVNAC 348
            .:.||  .|::::.:...:.|||:      |........:|..|.:.:.:.|.::||   ....|
  Fly   308 RYQCP--DCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPC 370

  Fly   349 ARNLHKFKITKPNELQ-----QLGKKP 370
            ..||.....::|..||     ..|:||
  Fly   371 KCNLCGKAFSRPWLLQGHIRTHTGEKP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
esgNP_476600.1 zf-C2H2 309..331 CDD:278523 6/23 (26%)
C2H2 Zn finger 311..331 CDD:275370 6/21 (29%)
zf-C2H2 344..366 CDD:278523 5/21 (24%)
C2H2 Zn finger 346..366 CDD:275368 5/19 (26%)
zf-C2H2 370..392 CDD:278523 6/21 (29%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
zf-H2C2_2 385..408 CDD:290200 5/13 (38%)
zf-C2H2 398..420 CDD:278523 80/417 (19%)
C2H2 Zn finger 400..420 CDD:275368
C2H2 Zn finger 428..444 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.