DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15446 and Snai3

DIOPT Version :9

Sequence 1:	NP_608430.2	Gene:	CG15446 / 33088	FlyBaseID:	FBgn0031155	Length:	373	Species:	Drosophila melanogaster
Sequence 2:	XP_006531137.1	Gene:	Snai3 / 30927	MGIID:	1353563	Length:	327	Species:	Mus musculus

Alignment Length:	134	Identity:	29/134 - (21%)
Similarity:	43/134 - (32%)	Gaps:	52/134 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   264 IQPLNSTPSANPPIFGANPMV------------------------------MGRH-------PPF 291
            :.||...|:..|||.|.:..:                              :.||       |..
Mouse   111 LPPLLVLPTRWPPILGPDGALNEHLRAEGTSRVPGSFECIHCHRPYHTLAGLARHQQLHCHLPTG 175

  Fly   292 SVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPHNCSKCGQVFR----TSGFMRMH------SVN 346
            ..|:|  .||.:.:.|..|:..|.|.   |..|..|..||:.|.    ..|.:|.|      :.:
Mouse   176 RAFTC--RYCDKEYASLGALKMHIRT---HTLPCICKVCGKAFSRPWLLQGHIRTHTGEKPYTCS 235

  Fly   347 ACAR 350
            .|:|
Mouse   236 HCSR 239

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15446	NP_608430.2	None
Snai3	XP_006531137.1	C2H2 Zn finger	149..169	CDD:275368	2/19 (11%)
		C2H2 Zn finger	180..200	CDD:275368	7/24 (29%)
		C2H2 Zn finger	206..226	CDD:275368	6/19 (32%)
		zf-C2H2	206..226	CDD:333835	6/19 (32%)
		zf-H2C2_2	219..242	CDD:372612	5/21 (24%)
		zf-C2H2	232..254	CDD:333835	2/8 (25%)
		C2H2 Zn finger	234..254	CDD:275368	2/6 (33%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900