DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and Snai3

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_008770833.1 Gene:Snai3 / 307919 RGDID:1309658 Length:328 Species:Rattus norvegicus


Alignment Length:281 Identity:52/281 - (18%)
Similarity:90/281 - (32%) Gaps:116/281 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SPTIEDEGKSGEQSVMQPKSK--KAN-------------KMPDKVADKLATKSEPKS--EESNVP 188
            :|....:|:..:| |.:|:.:  :||             .:|||.|.  :..|:|..  :.::..
  Rat    45 APQSVSQGEHQKQ-VWRPEDQYGEANGSCSACEELVGSCHLPDKEAS--SNPSDPLQPWDSTSAI 106

  Fly   189 VKIKVEGVEHNAE--GS-----QSDSMVNTNQGFTTNRNFIPILSSFPNPYRNMDVTWTEQFNAL 246
            ..:.:..:.|:.|  |:     |..|:|....|                  :...||..:.||  
  Rat   107 ACVSLPLLPHHGETLGTSGPEPQETSLVGPRAG------------------QAPSVTLKDSFN-- 151

  Fly   247 SNQYYNHIMNSISSLSQIQPLNSTPSANPPIFGANPMV--------------------------- 284
                             :.|:...|:..|||.|::..:                           
  Rat   152 -----------------LPPVLVLPTRWPPILGSDGALDEHLRAEGTSRVPGSFECIHCHRPYQT 199

  Fly   285 ---MGRH-------PPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWPHNCSKCGQVFR---- 335
               :.||       |....|:|  .||.:.:.|..|:..|.|.   |..|..|..||:.|.    
  Rat   200 LAGLARHQQLHCHLPTGCAFTC--RYCDKEYASLGALKMHIRT---HTLPCVCKVCGKAFSRPWL 259

  Fly   336 TSGFMRMH------SVNACAR 350
            ..|.:|.|      :.:.|:|
  Rat   260 LQGHIRTHTGEKPYTCSHCSR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
Snai3XP_008770833.1 C2H2 Zn finger 190..210 CDD:275370 2/19 (11%)
C2H2 Zn finger 221..241 CDD:275368 7/24 (29%)
zf-C2H2 245..267 CDD:278523 6/21 (29%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
COG5048 250..>295 CDD:227381 8/31 (26%)
zf-H2C2_2 260..283 CDD:290200 5/21 (24%)
zf-C2H2 273..295 CDD:278523 2/8 (25%)
C2H2 Zn finger 275..295 CDD:275368 2/6 (33%)
zf-H2C2_2 287..312 CDD:290200
C2H2 Zn finger 303..319 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.