DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15446 and ces-1

DIOPT Version :9

Sequence 1:NP_608430.2 Gene:CG15446 / 33088 FlyBaseID:FBgn0031155 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_492338.1 Gene:ces-1 / 185718 WormBaseID:WBGene00000468 Length:270 Species:Caenorhabditis elegans


Alignment Length:186 Identity:33/186 - (17%)
Similarity:71/186 - (38%) Gaps:29/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 SQSDSMVNTNQGFTTNRNFIPILSSFPNPYRNMDVTWTEQFNALSNQYYNHIMNSISSLSQIQPL 267
            |.:.|..:::...|::.|    |...|:..:|..|...:  |.|::|....:     .|...:.:
 Worm    44 SSAASTSSSSSSSTSSEN----LKKSPSSVQNTSVFSID--NILNSQKVPKL-----ELENDEDV 97

  Fly   268 NSTPSANPPIFG--------ANPMVMGRHPPFSVFSCPLDYCKENFDSRRAMYKHQRETGHHNWP 324
            :|:||......|        .:...:.:..|.|...|..|.|.:::.:...:.:|::.....:.|
 Worm    98 SSSPSPTCSTTGYTLDSLQNLDRRSLNKKGPSSHNRCVCDKCGKSYATTSNLSRHKQTHRALDSP 162

  Fly   325 H--NCSKCGQVFRTSGFMRM--------HSVNACARNLHKFKITKPNELQQLGKKP 370
            |  .|..|.:|:.:...:.|        |..|.|.:...:..:.:.:.....|.:|
 Worm   163 HAKQCPHCDRVYVSMPALSMHILTHNASHECNVCGKRFSRLWLLQGHLRSHTGLRP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15446NP_608430.2 None
ces-1NP_492338.1 C2H2 Zn finger 167..187 CDD:275368 4/19 (21%)
C2H2 Zn finger 193..213 CDD:275368 2/19 (11%)
zf-H2C2_2 206..229 CDD:290200 2/13 (15%)
zf-C2H2 219..241 CDD:278523 33/186 (18%)
C2H2 Zn finger 221..241 CDD:275368
zf-H2C2_2 233..257 CDD:290200
C2H2 Zn finger 249..268 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.