DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and TMH18

DIOPT Version :9

Sequence 1:NP_001285509.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_015423.2 Gene:TMH18 / 856213 SGDID:S000006302 Length:161 Species:Saccharomyces cerevisiae


Alignment Length:103 Identity:25/103 - (24%)
Similarity:43/103 - (41%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 AALVFLGAFATHFGSQIWMTFVSGLSLYFSLPRHVFGQCQQILFPRYF----------ALNAMLS 319
            |.|:|   ::..||...:.::|:....:..|.:..|...|..:||.:|          ||.|.::
Yeast     8 AHLLF---YSFVFGGTTFYSYVASPIAFKVLEKDQFSALQNKIFPYFFQMQAASPVILALTAPIA 69

  Fly   320 LT-----MLVVYA------KYFLSGWTTSAGIQMGSLA 346
            ||     .|||.:      .::|..||.....|..::|
Yeast    70 LTTGPLSSLVVASVSGLTNLFWLLPWTHKVKEQRKNIA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_001285509.1 DUF4149 272..371 CDD:290390 22/96 (23%)
TMH18NP_015423.2 DUF4149 11..105 CDD:404540 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004237
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104794
Panther 1 1.100 - - LDO PTHR23241
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5604
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.