DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and AT1G72100

DIOPT Version :9

Sequence 1:NP_001285509.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_177355.1 Gene:AT1G72100 / 843541 AraportID:AT1G72100 Length:480 Species:Arabidopsis thaliana


Alignment Length:161 Identity:41/161 - (25%)
Similarity:61/161 - (37%) Gaps:47/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 AEAAASATAASTRTATGGVMAALVFLGAFATHFGSQIWMTFVSGLSLYFSLPRHVFGQCQQILFP 309
            |....|||||   |.:...:|::|.|...|..||:.:|:||||...|...|.|..||..|..|:|
plant   293 AREFGSATAA---TLSPTKVASIVGLTGIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYP 354

  Fly   310 RYFALNAMLSLTMLVVYAKYFLSGWTTSAGIQMG---------------SLALAAGIEVVVRLYL 359
            .||.                     .||.||.:|               :..:..|:.::...::
plant   355 VYFK---------------------ATSVGILVGLFGHVLSRRRKLLTDATEMWQGVNLLSSFFM 398

  Fly   360 V--------PPMLQLMHEKYRIEDAIGSGQE 382
            :        |...:.|.|:.:.|...|.|.|
plant   399 IEANKSFVEPRATKAMFERMKAEKEEGRGGE 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_001285509.1 DUF4149 272..371 CDD:290390 27/121 (22%)
AT1G72100NP_177355.1 Apolipoprotein 88..252 CDD:279749
LEA_4 205..245 CDD:111833
LEA_4 227..269 CDD:111833
DUF4149 318..418 CDD:290390 27/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173611at2759
OrthoFinder 1 1.000 - - FOG0004237
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.