DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and AT1G22600

DIOPT Version :10

Sequence 1:NP_608428.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_173674.1 Gene:AT1G22600 / 838866 AraportID:AT1G22600 Length:385 Species:Arabidopsis thaliana


Alignment Length:126 Identity:27/126 - (21%)
Similarity:41/126 - (32%) Gaps:45/126 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   659 DYL--------------KILRAATKLVLSIREEASTVRIELSTCM-------------------R 690
            |||              .:|...|:...|: |..||:.:|.:|..                   |
plant    11 DYLFKVVLIGDSGVGKSNLLSRFTRNEFSL-ESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQER 74

  Fly   691 HMATSSA--RGHNLVLPTFGLFVKYAMGKWESWLNGCWDH---------VYDEITLRHVES 740
            :.|.:||  ||....|..:.:.........|.||....||         |.::..|||:.:
plant    75 YRAITSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMFVGNKADLRHLRA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_608428.1 DUF4149 272..372 CDD:463949
AT1G22600NP_173674.1 DUF4149 199..299 CDD:463949
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.