DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and AT1G22600

DIOPT Version :9

Sequence 1:NP_001285509.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_173674.1 Gene:AT1G22600 / 838866 AraportID:AT1G22600 Length:385 Species:Arabidopsis thaliana


Alignment Length:225 Identity:49/225 - (21%)
Similarity:74/225 - (32%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 ELQEEEPLAT----------------STPAAALKAQQQRKLSSMEPSMDDALAIGTQMTRQVSER 192
            |.:|.|..||                .|....:|.:....||...|.|..|     :...:|.|:
plant    83 EEEEREHHATPGELICDAIGKCKHKLGTVLGRVKDRTASDLSDETPEMTVA-----REALEVEEK 142

  Fly   193 ITCLVAKLQASRLYTILTRTTQPAHLIAVCI--LAFVLMTVGRDLIDPTTTVATAEAAASATAAS 255
            ::....:.:..    :..|.|:.||.:...:  :...:..:|       |.||||...       
plant   143 VSWKAREARGK----VNERATKKAHRVQKVLEKVQIAVRGIG-------TVVATALGL------- 189

  Fly   256 TRTATGGVMAALVFLGAFATHFGSQIWMTFVSGLSLYFSLPRHVFGQCQQILFPRYFALNAMLSL 320
              |..|.|:..:    ..|..:|..:|:|||||..|...|....||..|..::|.||.       
plant   190 --TKIGSVVGIV----GIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYFK------- 241

  Fly   321 TMLVVYAKYFLSGWTTSAGIQMGSLALAAG 350
                          ..|.||.:|.|....|
plant   242 --------------AVSVGILVGLLGHVIG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_001285509.1 DUF4149 272..371 CDD:290390 22/79 (28%)
AT1G22600NP_173674.1 DUF4149 199..299 CDD:290390 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2886
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173611at2759
OrthoFinder 1 1.000 - - FOG0004237
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.