DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and tmem205

DIOPT Version :9

Sequence 1:NP_001285509.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001037942.1 Gene:tmem205 / 733568 XenbaseID:XB-GENE-5820509 Length:188 Species:Xenopus tropicalis


Alignment Length:185 Identity:51/185 - (27%)
Similarity:76/185 - (41%) Gaps:26/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GVMAALVFLGAFATHFGSQIWMTFVSGLSLYFSLPRHVFGQCQQILFPRYFALNAMLSLTMLVVY 326
            |.:...:.|...:..:|.|.|.|||:|..|...:|||.||..|..|||.|..:....|...|.:|
 Frog     8 GNLVRTIHLLVLSASWGMQCWTTFVAGFVLIRGVPRHTFGLVQSKLFPFYNHIVLCCSFISLAIY 72

  Fly   327 AKY----FLSGWTTSAGIQMGSL---ALAAGIEVVVRLYLVPPMLQLMHEKYRIEDAIGSGQEVG 384
            |.|    .||   .|..:|:...   .|||.:..   .:..|...:.|.:.:.||.....||.||
 Frog    73 AAYHPRELLS---PSESVQITLFFVCLLAAALHA---RWFSPVTTKTMFKMHIIEREHSLGQGVG 131

  Fly   385 ---------SLVQGDLVDCPHYQRIHKGFRRIHMTIAIGNMTVMLTTCLQLYFLA 430
                     .|.:.|    |.|:.:.:.|.|.|...::.|:..:|.....|.::|
 Frog   132 LSANREAYQRLQEKD----PKYKALRQRFMRYHGISSLCNLLCLLCNGANLVYMA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_001285509.1 DUF4149 272..371 CDD:290390 32/105 (30%)
tmem205NP_001037942.1 DUF4149 17..118 CDD:372664 32/106 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11883
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173611at2759
OrthoFinder 1 1.000 - - FOG0004237
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5604
SonicParanoid 1 1.000 - - X4610
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.