DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32512 and Tmem205

DIOPT Version :9

Sequence 1:NP_001285509.1 Gene:CG32512 / 33085 FlyBaseID:FBgn0052512 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001100274.1 Gene:Tmem205 / 300441 RGDID:1563250 Length:189 Species:Rattus norvegicus


Alignment Length:187 Identity:54/187 - (28%)
Similarity:83/187 - (44%) Gaps:21/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 GVMAALVFLGAFATHFGSQIWMTFVSGLSLYFSLPRHVFGQCQQILFPRYFALN---AMLSLTML 323
            |.:..::.|...:..:|.|:|:||.||..|:.|||||.||..|..|||.||.::   |.::|.:|
  Rat     8 GSLIKVIHLLVLSGVWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHVSLGCAFINLCIL 72

  Fly   324 VVYAKYF-LSGWTTSAGIQMGSLALAAGIEVVVRLYLVPPMLQLMHEKYRIEDAIGSGQEVGSLV 387
            .....:. |:.|..|   |:..|.|:..:..:...:|.......|.....||...|.|.||...:
  Rat    73 APQRAWINLTLWEIS---QLTLLLLSLTLATINARWLEARTTATMWALQSIEKERGLGTEVPGSL 134

  Fly   388 QG----------DLVDCPHYQRIHKGFRRIHMTIAIGNMTVMLTTCLQLYFLASKIR 434
            ||          |    |.|..:.:.|...|...::.|:..:|:..|.|..||..:|
  Rat   135 QGPDPYRQLREKD----PKYSALRQKFFYYHGLSSLCNLGCLLSNGLCLVGLALGLR 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32512NP_001285509.1 DUF4149 272..371 CDD:290390 32/102 (31%)
Tmem205NP_001100274.1 DUF4149 17..114 CDD:404540 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11547
eggNOG 1 0.900 - - E1_KOG2886
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173611at2759
OrthoFinder 1 1.000 - - FOG0004237
OrthoInspector 1 1.000 - - oto95599
orthoMCL 1 0.900 - - OOG6_104794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4610
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.