DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and Popdc3

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_077248.1 Gene:Popdc3 / 78977 MGIID:1930153 Length:291 Species:Mus musculus


Alignment Length:215 Identity:57/215 - (26%)
Similarity:113/215 - (52%) Gaps:3/215 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNFIYLVV 167
            :.|......:.|:...|.:|.|::.::|.:|.|...:..::...|.|:..|:.:...:.|:..|.
Mouse    30 YHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLSSAVWAWVDICAADIFSWNFVLFVICFMQFVH 94

  Fly   168 VLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLV 232
            :..::..:.|.::...:|.:||:||.:....|:.:....:|: :|:.:..||.:..|.:|.||::
Mouse    95 IAYQVHSITFARDFHVLYSSLFKPLGIPLPVFRTIALSSEVV-SLEKEHCYAMQGKTSIDRLSVL 158

  Fly   233 LSGKLVVSQHQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAMEESRVLIWHRDKLKLSIMA 295
            :||::.|:.....||.:.|.||||||||..:  :.:..|||::.|..:.|.:.|.|.||.|....
Mouse   159 ISGRIRVTVDGEFLHYISPFQFLDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQ 223

  Fly   296 EPFLQTVFDHILGRDVVKKL 315
            ..::..:|..::|.|:..||
Mouse   224 HRYISRLFSVLIGSDIADKL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 57/215 (27%)
Popdc3NP_077248.1 Popeye 25..249 CDD:398483 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.