DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and Popdc3

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_006256661.1 Gene:Popdc3 / 641520 RGDID:1590760 Length:291 Species:Rattus norvegicus


Alignment Length:215 Identity:59/215 - (27%)
Similarity:112/215 - (52%) Gaps:3/215 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 FQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNFIYLVV 167
            |.|......:.|:...|.:|.|::.::|.:|.|...:..::...|.|:..|:.:...:.|:..|.
  Rat    30 FHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVH 94

  Fly   168 VLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDSLSLV 232
            :..::..:.|.:|...:|.:||:||.:....|:.:....:|: .|:.:..||.:..|.:|.||::
  Rat    95 IAYQVHSITFAREFHVLYSSLFKPLGIPLPVFRTIALSSEVV-TLEKEHCYAMQGKTSIDRLSVL 158

  Fly   233 LSGKLVVSQHQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAMEESRVLIWHRDKLKLSIMA 295
            :||::.|:.....||.:.|.||||||||..:  :.:..|||::.|..:.|.:.|.|.||.|....
  Rat   159 VSGRIRVTVDGEFLHYISPFQFLDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQ 223

  Fly   296 EPFLQTVFDHILGRDVVKKL 315
            ..::..:|..::|.|:..||
  Rat   224 HRYISRLFSVLIGSDIADKL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 59/215 (27%)
Popdc3XP_006256661.1 Popeye 25..249 CDD:398483 59/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46428
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.