DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and POPDC2

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001356848.1 Gene:POPDC2 / 64091 HGNCID:17648 Length:368 Species:Homo sapiens


Alignment Length:306 Identity:91/306 - (29%)
Similarity:143/306 - (46%) Gaps:45/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ADASAAGTLIAQSTAGTSAASSGTITW--DNNGTLRSINPGDWSIEQCLGPHHLYFQLGWAFLFL 112
            |::|..|.|:.|.:|        .|.|  |..|.:       :.:..||             |.|
Human     3 ANSSRVGQLLLQGSA--------CIRWKQDVEGAV-------YHLANCL-------------LLL 39

  Fly   113 AFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRF 177
            .|:...|.||..::...|..|.|...:.|:..|...|::|||.:...|..:.|..::.|||....
Human    40 GFMGGSGVYGCFYLFGFLSAGYLCCVLWGWFSACGLDIVLWSFLLAVVCLLQLAHLVYRLREDTL 104

  Fly   178 EQEIEAVYLALFQPLHVTRHQFKKVLNCM-KVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQ 241
            .:|.:.:|..|..||.|....:|::::|. :.:..|..::.||.|..|.::.|||:|||::.|||
Human   105 PEEFDLLYKTLCLPLQVPLQTYKEIVHCCEEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQ 169

  Fly   242 HQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQTVFD 304
            ..:.||.:||:||:|||||..:  |.:..|||::.|......:.|.|..|.|.:..|.::..:|.
Human   170 DGQFLHYIFPYQFMDSPEWESLQPSEEGVFQVTLTAETSCSYISWPRKSLHLLLTKERYISCLFS 234

  Fly   305 HILGRDVVKKLMQVTQVSESIASNGF-----LPS-----GGYAEDA 340
            .:||.|:.:||  .|...:..|..|.     |||     |..|.||
Human   235 ALLGYDISEKL--YTLNDKLFAKFGLRFDIRLPSLYHVLGPTAADA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 69/224 (31%)
POPDC2NP_001356848.1 Popeye 26..251 CDD:335914 73/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160532
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42276
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.