DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and Popdc2

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_006522501.1 Gene:Popdc2 / 64082 MGIID:1930150 Length:384 Species:Mus musculus


Alignment Length:279 Identity:79/279 - (28%)
Similarity:132/279 - (47%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SAAGTLIAQSTAGTSAASSGTITWDNNGTLRSINPGDWSIEQCLGPHHLYFQLGWAFLFLAFLAP 117
            ||.|:.:||            :.| .....||..|   .:|..:      :.|...||.:.|:|.
Mouse     2 SANGSSVAQ------------LLW-QPPVCRSWKP---DVEGAV------YHLANCFLLMGFMAG 44

  Fly   118 HGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIE 182
            .|.||..::..:|..|.|...:.|:..|...|::||:.:......:.|..::.|:|.....:|..
Mouse    45 SGVYGCFYLFGILGPGYLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFN 109

  Fly   183 AVYLALFQPLHVTRHQFKKVLNCM-KVIRALKYQEVYAQEKVTKVDSLSLVLSGKLVVSQHQRAL 246
            .:|..|..||.|....:|::::|. :.:..|..::.||.|..|.::.|||:|||::.|||..:.|
Mouse   110 LLYRTLCLPLQVPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFL 174

  Fly   247 HIVFPHQFLDSPEWFGV--STDDYFQ-------------VSIMAMEESRVLIWHRDKLKLSIMAE 296
            |.:||:||:|||||..:  |.:..||             |::.|..|...:.|.|..|.|.:..|
Mouse   175 HYIFPYQFMDSPEWESLHPSEEGTFQVIRSPEAAQSPATVTLTAETECSYISWPRKNLYLLLNRE 239

  Fly   297 PFLQTVFDHILGRDVVKKL 315
            .::..:|..:||.|:.:||
Mouse   240 RYISRLFSALLGYDISEKL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 69/234 (29%)
Popdc2XP_006522501.1 Popeye 26..264 CDD:368146 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44330
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.