DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and popdc3

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001016293.1 Gene:popdc3 / 549047 XenbaseID:XB-GENE-6257868 Length:289 Species:Xenopus tropicalis


Alignment Length:276 Identity:80/276 - (28%)
Similarity:138/276 - (50%) Gaps:22/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 WSIEQCLGPHHLYFQLGWAFLF-LAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILW 153
            |.:|.....:||.     :.|| |..:...|.:|.|::.....|..|...:..::...|.||..|
 Frog    21 WKLEAEGSIYHLA-----SVLFVLGCMGGSGYFGLLYVYIFFAISFLCTSIWAWMDVCAADVFSW 80

  Fly   154 SGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVLN-CMKVIRALKYQEV 217
            :.:.|.:..:.::.:..:||.|.|::|.:.||.|:|:||.::...|:|::: |...:..|:....
 Frog    81 NFILLVICIVQIIHLAYQLRSVTFDKEFQDVYSAVFKPLGISLTIFRKIISYCNAEVVTLERDHC 145

  Fly   218 YAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAMEESR 280
            ||.:..|.:|.|||::||::.|:.....||.:||.||||||||..:  |.:..|||::.|..:.|
 Frog   146 YAVQGKTPIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLKPSEEGIFQVTLTAETKCR 210

  Fly   281 VLIWHRDKLKLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIASNGF-----LPSGGYAEDA 340
            .:.|.|.||.|......||..:|..::..|:..||..:.  .:....:||     ||: .|....
 Frog   211 YVTWRRKKLYLLFAKHRFLAKLFSLLISSDIADKLYALN--DKVFIDSGFRFDIRLPN-YYHRAV 272

  Fly   341 EDK-----PMLILKKS 351
            .|:     |::.::||
 Frog   273 PDQAPSTVPIIRIQKS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 69/225 (31%)
popdc3NP_001016293.1 Popeye 25..251 CDD:368146 69/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.