DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and popdc3

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001001848.1 Gene:popdc3 / 415108 ZFINID:ZDB-GENE-040624-10 Length:298 Species:Danio rerio


Alignment Length:267 Identity:77/267 - (28%)
Similarity:124/267 - (46%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 PHHLYFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNF 162
            |....|.|....|.|.|:...|.||.|:|...|.:|.....:..:......|...|:    |..|
Zfish    26 PEGSVFHLAHILLVLGFMGGSGFYGLLYMFCFLTLGFFCYSIWAWSDPCTTDSFSWT----FALF 86

  Fly   163 IY----LVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVL-NCMKVIRALKYQEVYAQEK 222
            .:    |:.|..|||.|.||:|.:.:|..||:.|.|:...|.|:: :|...:..::....:|.|.
Zfish    87 AFCLGQLIHVAYRLRSVTFEKEFQDLYECLFKKLGVSLIHFGKIVESCEGDVHTIEKDHFFAMEG 151

  Fly   223 VTKVDSLSLVLSGKLVVSQHQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAMEESRVLIWH 285
            .|.:|.||:::||::.|:.:...||.::|.||||||||..:  |.:.:|||::.|....|.:.|.
Zfish   152 KTPIDKLSVLVSGRIRVTVNGEFLHFIYPFQFLDSPEWDSLRPSEEGFFQVTLRADIRCRYVAWR 216

  Fly   286 RDKLKLSIMAEPFLQTVFDHILGRDVVKKLMQVTQVSESIAS-----------NGFLPSGGYAED 339
            |.||.|......::..:|..::..|:.:||..:...:..|..           ||  |....|..
Zfish   217 RKKLYLLFAQHRYIAKIFALLVRNDIAEKLFSLNDKAFDIRGFRYDLRLPSFCNG--PGPEIANT 279

  Fly   340 AEDKPML 346
            .|.:|:|
Zfish   280 NESRPVL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 69/228 (30%)
popdc3NP_001001848.1 Popeye 26..252 CDD:282660 69/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.