DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and BVES

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001186492.1 Gene:BVES / 11149 HGNCID:1152 Length:360 Species:Homo sapiens


Alignment Length:277 Identity:84/277 - (30%)
Similarity:140/277 - (50%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 HHLYFQLGWAFLFLAFLAP-----HGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDVILWSGMGL 158
            |||.|.:......:..:.|     |    .:::|.||.:||.:..:...|...|.|:::|:.:.|
Human    41 HHLVFHVANICFAVGLVIPTTLHLH----MIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFL 101

  Fly   159 FVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVLNCMKVIRALKYQEVYAQEKV 223
            .||.::|..:|.:.|||:.|:|:..:|..||:||.|....|:::.....:|:.||..:.||.|..
Human   102 GVNILHLSYLLYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDK 166

  Fly   224 TKVDS-LSLVLSGKLVVSQHQRALHIVFPHQFLDSPEWFG--VSTDDYFQVSIMAMEESRVLIWH 285
            |.||. ||::|.||:.||.....||.::|..|:||||:..  :...:.|||:|:|.:..|.|.|.
Human   167 TSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWS 231

  Fly   286 RDKLKLSIMAEPFLQTVFDHILGRDVVKKLMQV--------------------TQVS-----ESI 325
            |::|...:.:||||..:|.:::|:|:..||..:                    ||:|     .||
Human   232 RERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSI 296

  Fly   326 ASNGFLPSGGYAEDAED 342
            ||         :.|::|
Human   297 AS---------SSDSDD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 75/248 (30%)
BVESNP_001186492.1 Popeye 40..267 CDD:309806 75/229 (33%)
Required for interaction with CAV3. /evidence=ECO:0000250|UniProtKB:Q9ES83 93..115 6/21 (29%)
Required for interaction with KCNK2. /evidence=ECO:0000269|PubMed:26642364 136..186 18/49 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160533
Domainoid 1 1.000 133 1.000 Domainoid score I5098
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4618
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 1 1.000 - - FOG0007052
OrthoInspector 1 1.000 - - otm42276
orthoMCL 1 0.900 - - OOG6_107413
Panther 1 1.100 - - O PTHR12101
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.