DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and popdc2

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_031752282.1 Gene:popdc2 / 100489812 XenbaseID:XB-GENE-958806 Length:349 Species:Xenopus tropicalis


Alignment Length:233 Identity:74/233 - (31%)
Similarity:127/233 - (54%) Gaps:7/233 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 WSIEQCLGPHHL----YFQLGWAFLFLAFLAPHGPYGALWMRAMLLIGCLMMGMHGYLVAFAPDV 150
            ::..:|.|..|.    .:.||...|.|||:...|.||.:::.|::..|.|...:.|:|.|...|:
 Frog    13 YTYPECDGWKHFVEGAIYHLGNLLLILAFMGGSGIYGCIYIFALMGAGFLCFALWGWLSACGVDI 77

  Fly   151 ILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLHVTRHQFKKVLNCMKV-IRALKY 214
            .:|:.:.|.:....:..:|.:||...:.:..:.:|..|:|||.|....||::.:|..: :..|..
 Frog    78 FVWNLLLLIMCLAQISHLLYQLRKESYGEHYDTLYRTLYQPLQVPLEVFKEIAHCSGMEVHYLSA 142

  Fly   215 QEVYAQEKVTKVDSLSLVLSGKLVVSQHQRALHIVFPHQFLDSPEWFGV--STDDYFQVSIMAME 277
            .:.||.|..|.::.|||:|||::.||...:.||.:||:||||||||..:  |.:..|||::.|..
 Frog   143 DQSYALEGKTPIERLSLLLSGRVKVSLEGQFLHYIFPYQFLDSPEWESLRPSEEGSFQVTLTAET 207

  Fly   278 ESRVLIWHRDKLKLSIMAEPFLQTVFDHILGRDVVKKL 315
            :...:.|.|.:|.|.:..|.::..:|..:||.|:.:||
 Frog   208 DCVFVSWPRKRLYLLLAKEKYISRLFSVLLGFDISQKL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 72/225 (32%)
popdc2XP_031752282.1 Popeye 25..251 CDD:398483 71/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5347
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4524
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49507
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2944
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.