DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bves and bves

DIOPT Version :9

Sequence 1:NP_608426.1 Gene:bves / 33083 FlyBaseID:FBgn0031150 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_012818148.1 Gene:bves / 100144641 XenbaseID:XB-GENE-484277 Length:344 Species:Xenopus tropicalis


Alignment Length:292 Identity:79/292 - (27%)
Similarity:144/292 - (49%) Gaps:27/292 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TITWDNNGTLRSI----NPGDWSIEQCLGPHHLYFQLGWAFLFLAFLAP-----HGPYGALWMRA 128
            |:..|.|..:.::    |..:...|.....|||.|.|.........:.|     |    .:.:|.
 Frog    10 TLPMDLNSQINNVTFGLNENETLCENWREIHHLVFHLANTCFAAGLVIPSTLNLH----MILLRG 70

  Fly   129 MLLIGCLMMGMHGYLVAFAPDVILWSGMGLFVNFIYLVVVLCRLRPVRFEQEIEAVYLALFQPLH 193
            ||.:||:...:...|...|.|:::|:...|.:||::.:.::.:.||::.|::::.:|..:|:|||
 Frog    71 MLCLGCIFFIIWAILFRCALDIMIWNATFLSMNFMHFIYLVYKKRPIKIEKDLKGIYHRMFEPLH 135

  Fly   194 VTRHQFKKVLNCMKVIRALKYQEVYAQEKVTKVDS-LSLVLSGKLVVSQHQRALHIVFPHQFLDS 257
            |:...|.::......|:.|...:.||.|..|.||. ||::|.|.:.||.....||.:.|:.::||
 Frog   136 VSPELFNRLTGQFCEIKTLAKGQTYAIEDKTSVDDRLSILLKGIMKVSYRGHFLHAISPNAYIDS 200

  Fly   258 PEWFG--VSTDDYFQVSIMAMEESRVLIWHRDKLKLSIMAEPFLQTVFDHILGRDVVKKLMQVTQ 320
            ||:..  ::..:.|||:|.|.:....|.|.|::|...:.:||||..:|.:::|:|:..||..:..
 Frog   201 PEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLESEPFLYEIFKYLIGKDITTKLYSLND 265

  Fly   321 VSESIASNGFLPSGGYAEDAEDKPMLILKKSV 352
                       |:.|..:..:.:|.|..:.||
 Frog   266 -----------PTLGKKKKLDTQPSLCSQLSV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bvesNP_608426.1 Popeye 98..320 CDD:282660 68/229 (30%)
bvesXP_012818148.1 Popeye 40..266 CDD:368146 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5347
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1369469at2759
OrthoFinder 1 1.000 - - FOG0007052
OrthoInspector 1 1.000 - - otm49507
Panther 1 1.100 - - O PTHR12101
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5603
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.050

Return to query results.
Submit another query.