DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnf150 and H10E21.5

DIOPT Version :9

Sequence 1:XP_017168354.1 Gene:Rnf150 / 330812 MGIID:2443860 Length:450 Species:Mus musculus
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:172 Identity:87/172 - (50%)
Similarity:117/172 - (68%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse   204 SRTSVVFVSISFIVLMIISLAWLVFYYIQRFRYANARDRNQYTIATGQDWQLYRRRLGDAAKKAI 268
            |:|||:|||||||:||:||||||||||:||||||:|:||.|             |||.:||:||:
 Worm   156 SKTSVLFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQ-------------RRLFNAARKAL 207

Mouse   269 SKLQVRTIRKG-DKETESDFDNCAVCIEGYKPNDVVRILPCRHLFHKSCVDPWLLDHRTCPMCKM 332
            :::...||..| .:|.:||   ||||::.|:..||:|:|||:|::||||:|||||:||||||||.
 Worm   208 TRIPTMTITPGMTQELQSD---CAVCLDPYQLQDVIRLLPCKHIYHKSCIDPWLLEHRTCPMCKN 269

Mouse   333 NILKALGIPPNADCMDDLPIDFEGSLGGPPTNQITGASDTTV 374
            :|||..|.      .:|:..|.:     .|||....|.|.|:
 Worm   270 DILKHFGY------WNDIRNDIQ-----MPTNSRGIADDFTI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnf150XP_017168354.1 PA_GRAIL_like 45..192 CDD:239037
RING-H2_GRAIL 289..336 CDD:319582 30/46 (65%)
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 87/172 (51%)
RING-H2_GRAIL 226..273 CDD:319582 31/49 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C163567035
Domainoid 1 1.000 84 1.000 Domainoid score I5750
eggNOG 1 0.900 - - E33208_3BHU7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3321
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000832
OrthoInspector 1 1.000 - - otm16989
orthoMCL 1 0.900 - - OOG6_107948
Panther 1 1.100 - - O PTHR22765
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3602
SonicParanoid 1 1.000 - - X295
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.680

Return to query results.
Submit another query.