DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and DES1

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001330587.1 Gene:DES1 / 832873 AraportID:AT5G28030 Length:323 Species:Arabidopsis thaliana


Alignment Length:334 Identity:121/334 - (36%)
Similarity:179/334 - (53%) Gaps:21/334 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RQQITPNILEVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLK 106
            |..|..::.|:||.||:|.||.|  .||....:.||.|.:.|..|:||||.|.|::|||::||:.
plant     4 RVLIKNDVTELIGNTPMVYLNKI--VDGCVARIAAKLEMMEPCSSIKDRIAYSMIKDAEDKGLIT 66

  Fly   107 PG-YTIIEPTSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPE 170
            || .|:||.|.||||||||...|.:|||.|::||..||.|:...||.|||::..|......   :
plant    67 PGKSTLIEATGGNTGIGLASIGASRGYKVILLMPSTMSLERRIILRALGAEVHLTDISIGI---K 128

  Fly   171 GLIYVAQQLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGR 235
            |.:..|:::..:||...:..|:.|..||..||..|..||......|||::|...||.||::|.|:
plant   129 GQLEKAKEILSKTPGGYIPHQFINPENPEIHYRTTGPEIWRDSAGKVDILVAGVGTGGTVTGTGK 193

  Fly   236 KIKEQVPSCQIVGVDPYGSIL---ARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGD 297
            .:||:....::..|:|..|.:   .:|..        :.::|||....|...|.::||...::..
plant   194 FLKEKNKDIKVCVVEPSESAVLSGGKPGP--------HLIQGIGSGEIPANLDLSIVDEIIQVTG 250

  Fly   298 SDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKK-GQRCVVILPDGIRNYM-TKFVSDNWM 360
            .:....::.|..:||||.|.|||.:..|||:.|::.:. |:..|||.|.|...|: |:.......
plant   251 EEAIETTKLLAIKEGLLVGISSGASAAAALKVAKRPENVGKLIVVIFPSGGERYLSTELFESVRY 315

  Fly   361 EARNFKEPV 369
            ||.|.  ||
plant   316 EAENL--PV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 120/331 (36%)
CBS_like 54..352 CDD:107204 111/303 (37%)
CBS_pair_PALP_assoc 386..504 CDD:239981
DES1NP_001330587.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 206 1.000 Domainoid score I821
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1254
OMA 1 1.010 - - QHG54083
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 1 1.000 - - otm2614
orthoMCL 1 0.900 - - OOG6_100154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.