DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and CYSC1

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_191703.1 Gene:CYSC1 / 825317 AraportID:AT3G61440 Length:368 Species:Arabidopsis thaliana


Alignment Length:326 Identity:114/326 - (34%)
Similarity:174/326 - (53%) Gaps:22/326 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPG-YTIIEPT 115
            :||.||||.||.:  ::|.|..:.||.|...|..|:|||....|:.|||::.|:.|| .|:||||
plant    56 LIGKTPLVFLNKV--TEGCEAYVAAKQEHFQPTCSIKDRPAIAMIADAEKKKLIIPGKTTLIEPT 118

  Fly   116 SGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGL---IYVAQ 177
            |||.||.||...|:|||:.|:.||...|.|:...:|:.||:::.|      |..:|:   :..|.
plant   119 SGNMGISLAFMAAMKGYRIIMTMPSYTSLERRVTMRSFGAELVLT------DPAKGMGGTVKKAY 177

  Fly   178 QLQRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQ--LDNKVDMIVVSAGTAGTISGIGRKIKEQ 240
            .|...||::.:..|:.|..|...|:|.|..|| |:  |.| ||:.|:..|:.||:||:||.:|.:
plant   178 DLLDSTPDAFMCQQFANPANTQIHFDTTGPEI-WEDTLGN-VDIFVMGIGSGGTVSGVGRYLKSK 240

  Fly   241 VPSCQIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSR 305
            .|:.:|.||:|..|.:     ||......:.:.|.|..|.|.:.|..|::...::...|...|:|
plant   241 NPNVKIYGVEPAESNI-----LNGGKPGPHAITGNGVGFKPEILDMDVMESVLEVSSEDAIKMAR 300

  Fly   306 RLNAEEGLLCGGSSGGAMHAALEHARKLK-KGQRCVVILPDGIRNYMTKFVSDNWMEARNFKEPV 369
            .|..:|||:.|.|||....||:..|:..: ||:..|.|.......|::..:.|...:.....:||
plant   301 ELALKEGLMVGISSGANTVAAIRLAKMPENKGKLIVTIHASFGERYLSSVLFDELRKEAEEMKPV 365

  Fly   370 N 370
            :
plant   366 S 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 114/326 (35%)
CBS_like 54..352 CDD:107204 110/304 (36%)
CBS_pair_PALP_assoc 386..504 CDD:239981
CYSC1NP_191703.1 PLN02556 1..368 CDD:178171 114/326 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 206 1.000 Domainoid score I821
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1254
OMA 1 1.010 - - QHG54083
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 1 1.000 - - otm2614
orthoMCL 1 0.900 - - OOG6_100154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.