DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and CS26

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_187013.1 Gene:CS26 / 821203 AraportID:AT3G03630 Length:404 Species:Arabidopsis thaliana


Alignment Length:354 Identity:120/354 - (33%)
Similarity:178/354 - (50%) Gaps:43/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GKPSKCKWHLGTAEKS--------PHIHRGIAHRQQI----TPNILE----VIGCTPLVKLNNIP 65
            ||.|     .||..||        |.....:|..|.|    |.||.|    :||.||:|.||.: 
plant    60 GKSS-----TGTKSKSKTKRKPPPPPPVTTVAEEQHIAESETVNIAEDVTQLIGSTPMVYLNRV- 118

  Fly    66 ASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTI-IEPTSGNTGIGLAMACAV 129
             :||...::.||.|.:.|..|||||||..|:.:||..|.:.|..|: :|||:||||:|:|...|.
plant   119 -TDGCLADIAAKLESMEPCRSVKDRIGLSMINEAENSGAITPRKTVLVEPTTGNTGLGIAFVAAA 182

  Fly   130 KGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSIVLDQYRN 194
            ||||.|:.||..::.|:...||.|||:|:.|..|...   :|.:..|:::..:|.|:.:..|:.|
plant   183 KGYKLIVTMPASINIERRMLLRALGAEIVLTNPEKGL---KGAVDKAKEIVLKTKNAYMFQQFDN 244

  Fly   195 AGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPYGSILARP 259
            ..|...|::.|..||.......||:.|...||.||::|.|..:|......::|||:|        
plant   245 TANTKIHFETTGPEIWEDTMGNVDIFVAGIGTGGTVTGTGGFLKMMNKDIKVVGVEP-------- 301

  Fly   260 AELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMH 324
               ::..|    :.|....:.|.:.|..::|...|:.:.:...|:|||..|||||.|.|||.|..
plant   302 ---SERSV----ISGDNPGYLPGILDVKLLDEVFKVSNGEAIEMARRLALEEGLLVGISSGAAAV 359

  Fly   325 AALEHARKLKK-GQRCVVILPDGIRNYMT 352
            ||:..|::.:. |:...|:.|.....|:|
plant   360 AAVSLAKRAENAGKLITVLFPSHGERYIT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 110/318 (35%)
CBS_like 54..352 CDD:107204 103/299 (34%)
CBS_pair_PALP_assoc 386..504 CDD:239981
CS26NP_187013.1 PLN02565 95..404 CDD:166206 109/314 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 206 1.000 Domainoid score I821
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I1254
OMA 1 1.010 - - QHG54083
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 1 1.000 - - otm2614
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.