DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and F59A7.7

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_503549.1 Gene:F59A7.7 / 186586 WormBaseID:WBGene00019094 Length:162 Species:Caenorhabditis elegans


Alignment Length:197 Identity:47/197 - (23%)
Similarity:85/197 - (43%) Gaps:44/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDPY-GSILA----RPAELNKTDVQFYEVEGIGYD 278
            |:....|:.||::|:||.::.|..:..:..|:|: .|:|:    .|          :::.|||..
 Worm     1 MVCFGVGSGGTVTGVGRYLRAQKQNIGVYPVEPFESSVLSGFPRGP----------HKIHGIGAG 55

  Fly   279 FPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCGGSSGGAMHAALEHARKLKKGQRCVVIL 343
            ..|...|.::.....::...|...|:|||..||.:|...|||..:.||:|.|.:           
 Worm    56 LIPGNVDRSLFTEVLRVKSEDAMKMARRLADEEAILGEISSGANVVAAVELACR----------- 109

  Fly   344 PDGIRNYMTKFVSDNWMEARNFKEPVNEHGHWWWSLAIAEL-ELPAPPVILKSDATVGEAIALMK 407
            |:.|...:...|  |....|.|...:       :|..::|: :||.        :|..:|:.:.|
 Worm   110 PENIGKLIVTTV--NSFAERYFSTEL-------YSTLLSEVSKLPI--------STDEQAVDIAK 157

  Fly   408 KH 409
            |:
 Worm   158 KY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 47/197 (24%)
CBS_like 54..352 CDD:107204 35/137 (26%)
CBS_pair_PALP_assoc 386..504 CDD:239981 6/24 (25%)
F59A7.7NP_503549.1 Trp-synth-beta_II <17..134 CDD:294246 33/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.