DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and cbs-2

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_494215.2 Gene:cbs-2 / 186197 WormBaseID:WBGene00018783 Length:662 Species:Caenorhabditis elegans


Alignment Length:376 Identity:195/376 - (51%)
Similarity:248/376 - (65%) Gaps:28/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KPYERPADFIDPG----KPSKC--KWHLGTAEKSPHIHRGIAHRQQITPNILEVIGCTPLVKLNN 63
            ||. :|.:..||.    .|:|.  :|      ||....|  ..|..:..::|:.||.||||||.:
 Worm   299 KPI-KPREIFDPKVLDYDPTKMVGEW------KSSSKFR--PERPLVLDSVLDAIGKTPLVKLQH 354

  Fly    64 IPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPG------YTIIEPTSGNTGIG 122
            :|.:.|:.|.:|.||||||.|||.||||..:||:.||:.|  |||      .|:|||||||||||
 Worm   355 VPKAHGVRCNVYVKCEFLNAGGSTKDRIAKKMVEIAEKTG--KPGALTPGATTLIEPTSGNTGIG 417

  Fly   123 LAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQLQRETPNSI 187
            |::..||:||||:|.||||||.||.:.|..||:.|:|||.|||::||...|.||.:|:.|.|.::
 Worm   418 LSLVAAVRGYKCLITMPEKMSKEKSTTLSVLGSTIVRTPNEAAFNSPSSHIGVALRLKHEIPGAV 482

  Fly   188 VLDQYRNAGNPLAHYDGTAAEILWQL-DNKVDMIVVSAGTAGTISGIGRKIKEQVPSCQIVGVDP 251
            :||||.|.|||||||:.||.||||.: |.|:|::|:.|||.|||:||.|||.|:.|:..:|||||
 Worm   483 ILDQYCNPGNPLAHYEETAEEILWDMGDRKIDLVVLGAGTGGTITGISRKIHERRPNAIVVGVDP 547

  Fly   252 YGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNAEEGLLCG 316
            .||||..|......|  |||||||||||.|...|:..||.|.|..|.:.|.|:|.:...||:|||
 Worm   548 NGSILTGPTTGPAPD--FYEVEGIGYDFIPGTLDEKSVDSWLKSDDKESFLMAREIIRTEGILCG 610

  Fly   317 GSSGGAMHAALEHARK--LKKGQRCVVILPDGIRNYMTKFVSDNWMEARNF 365
            ||||.|:|.|||..||  |.:....||:||||||||:|||:.|:||:||.|
 Worm   611 GSSGCAVHYALEQCRKLDLPEDANVVVLLPDGIRNYLTKFLDDDWMKARGF 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 183/330 (55%)
CBS_like 54..352 CDD:107204 172/306 (56%)
CBS_pair_PALP_assoc 386..504 CDD:239981
cbs-2NP_494215.2 Trp-synth-beta_II 21..290 CDD:294246
PALP 21..280 CDD:278708
PLN02565 340..653 CDD:166206 177/316 (56%)
CBS_like 345..648 CDD:107204 172/306 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160997
Domainoid 1 1.000 332 1.000 Domainoid score I605
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 1 1.000 - - otm14127
orthoMCL 1 0.900 - - OOG6_100154
Panther 1 1.100 - - O PTHR10314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R286
SonicParanoid 1 1.000 - - X341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.