DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbs and cysl-2

DIOPT Version :9

Sequence 1:NP_001285508.1 Gene:Cbs / 33081 FlyBaseID:FBgn0031148 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_497008.1 Gene:cysl-2 / 175107 WormBaseID:WBGene00010759 Length:337 Species:Caenorhabditis elegans


Alignment Length:320 Identity:117/320 - (36%)
Similarity:179/320 - (55%) Gaps:13/320 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EVIGCTPLVKLNNIPASDGIECEMYAKCEFLNPGGSVKDRIGYRMVQDAEEQGLLKPGYTI-IEP 114
            |:||.|||:|||.|....|  ..:..|.|::||..||||||.:.|:..||:.||:.||.|: |||
 Worm    12 ELIGNTPLLKLNKIGKDLG--ASIAVKVEYMNPACSVKDRIAFNMIDTAEKAGLITPGKTVLIEP 74

  Fly   115 TSGNTGIGLAMACAVKGYKCIIVMPEKMSNEKVSALRTLGAKIIRTPTEAAYDSPEGLIYVAQQL 179
            ||||.||.||....::|||.|:.||..||.|:...|:..||::|.|....|.   :|.:..|::|
 Worm    75 TSGNMGIALAYCGKLRGYKVILTMPASMSIERRCLLKAYGAEVILTDPATAV---KGAVQRAEEL 136

  Fly   180 QRETPNSIVLDQYRNAGNPLAHYDGTAAEILWQLDNKVDMIVVSAGTAGTISGIGRKIKEQVPSC 244
            :...||:.:|:|:.|..||.|||..|..||..|...|||::....|:.||.:|:||.:||:.||.
 Worm   137 RDVIPNAYILNQFGNPANPEAHYKTTGPEIWRQTQGKVDIVCFGVGSGGTCTGVGRFLKEKNPSV 201

  Fly   245 QIVGVDPYGSILARPAELNKTDVQFYEVEGIGYDFPPTVFDDTVVDVWTKIGDSDCFPMSRRLNA 309
            |:..|:|:.|     :.:|......::::|:|....|.:.|.|:.....::...|...|:::|..
 Worm   202 QVFPVEPFES-----SVINGLPHSPHKIQGMGTGMIPDILDLTLFSEALRVHSDDAIAMAKKLAD 261

  Fly   310 EEGLLCGGSSGGAMHAALEHARKLK-KGQRCVVILPD-GIRNYMTKFVSDNWMEARNFKE 367
            ||.:|.|.|||..:.||::.|::.: ||:..|..:.. |.|...|...::....|.|.|:
 Worm   262 EESILGGISSGANVCAAVQLAKRPENKGKLIVTTVNSFGERYLSTALYAELRDNAANMKQ 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CbsNP_001285508.1 cysta_beta 45..505 CDD:273464 117/320 (37%)
CBS_like 54..352 CDD:107204 111/300 (37%)
CBS_pair_PALP_assoc 386..504 CDD:239981
cysl-2NP_497008.1 PLN02565 12..320 CDD:166206 116/317 (37%)
CBS_like 15..305 CDD:107204 111/299 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I2347
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54083
OrthoDB 1 1.010 - - D1016546at2759
OrthoFinder 1 1.000 - - FOG0000642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X341
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.