DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSPA4 and Hsc70-5

DIOPT Version :9

Sequence 1:NP_002145.3 Gene:HSPA4 / 3308 HGNCID:5237 Length:840 Species:Homo sapiens
Sequence 2:NP_001286414.1 Gene:Hsc70-5 / 36583 FlyBaseID:FBgn0001220 Length:686 Species:Drosophila melanogaster


Alignment Length:651 Identity:185/651 - (28%)
Similarity:298/651 - (45%) Gaps:104/651 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     2 SVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPK-NRSIGAAAKSQVISNAKNTVQ 65
            :|:|||||..:..:||......:.|.|....|.||:.::|... .|.:|..||.|.::|:.||..
  Fly    53 AVIGIDLGTTNSCLAVMEGKQAKVIENAEGARTTPSHVAFTKDGERLVGMPAKRQAVTNSANTFY 117

Human    66 GFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAE 130
            ..||..||.|.||.|:.:.:||:|.:|:...|...:..|   :.:.::..|:.|.:|.|:|||||
  Fly   118 ATKRLIGRRFDDPEVKKDITNLSYKVVKASNGDAWVSST---DGKVYSPSQIGAFILMKMKETAE 179

Human   131 SVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKP 195
            :.|..||.:.||:||.::.|::|::..||.||||||.||::||.||.|||||:.|.:       .
  Fly   180 AYLNTPVKNAVVTVPAYFNDSQRQATKDAGQIAGLNVLRVINEPTAAALAYGMDKTE-------D 237

Human   196 RNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKI 260
            :.:...|:|...:.:|:....:|..:|.:|..||.|||..||..:||....||.|...:||:...
  Fly   238 KIIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTLLGGEDFDNHIVNFLVAEFKKDSGIDIRKDN 302

Human   261 RALLRLSQECEKLK-KLMSANASDLPLSIECFMNDVDVSG------TMNRGKFLEMCNDLLARVE 318
            .|:.||.:..||.| :|.|:..:|:.|.   ::. :|.:|      .:.|.|...:..||:.|..
  Fly   303 IAMQRLKEAAEKAKCELSSSQQTDINLP---YLT-MDAAGPQHMNLKLTRSKLESLVGDLIKRTI 363

Human   319 PPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGKELSTTLNADEAVTRGCALQCAIL 383
            .|.:..|...::.|.:|..|.:|||.||:|.|:..:.:.||::.|.::|.||||..|.|:|..:|
  Fly   364 QPCQKALSDAEVSKSEIGEVLLVGGMTRMPKVQSTVQELFGRQPSRSVNPDEAVAVGAAVQGGVL 428

Human   384 SPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVFSKNHAAPFSKVLTF-------------- 434
              |..|.:..:.||.|..:.:.     ..|.....:.|:|...|..|...|              
  Fly   429 --AGDVTDVLLLDVTPLSLGIE-----TLGGVFTRLISRNTTIPTKKSQVFSTASDGQTQVEIKV 486

Human   435 YRKE-----------PFTLEAYYSSPQDLPYPD-------PAIAQFSV--------QKVTPQSDG 473
            ::.|           .|||.....:|:.:|..:       ..|...|.        |::..||.|
  Fly   487 HQGEREMANDNKLLGSFTLVGIPPAPRGVPQIEVVFDIDANGIVHVSAKDKGTGKEQQIVIQSSG 551

Human   474 SSSKVKVK---VRVNVHGIFSVSSASLVE--------VHKSEENEEPMETDQNAKEEEKMQ---- 523
            ..||.:::   .:...:.........|:|        ||.:|...|..::...|:|.||::    
  Fly   552 GLSKDEIENMIKKAEEYATADKQKRELIEIVNQGESIVHDTETKMEEFKSQLPAEECEKLKKEIA 616

Human   524 ------VDQEEPHVEEQQQQTP------------AENKAESEEMETSQAGSKD--KKMDQPPQAK 568
                  .::|...:||.::.|.            |..|..:|....:.|||.|  ...|...:||
  Fly   617 DLRTLLANKETADLEEVRKATSSLQQSSLKLFELAYKKMSAERESNAGAGSSDSSSSSDTSGEAK 681

Human   569 K 569
            |
  Fly   682 K 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSPA4NP_002145.3 HSPA4_NBD 2..384 CDD:212687 134/389 (34%)
HSP70 3..607 CDD:278441 185/650 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..575 23/94 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 779..840
Hsc70-5NP_001286414.1 dnaK 51..666 CDD:234715 177/633 (28%)
HSPA9-like_NBD 51..428 CDD:212683 134/388 (35%)
Syntaphilin <566..>642 CDD:291936 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.