DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15449 and CG9628

DIOPT Version :9

Sequence 1:NP_608423.1 Gene:CG15449 / 33079 FlyBaseID:FBgn0031146 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001163442.1 Gene:CG9628 / 39593 FlyBaseID:FBgn0036433 Length:175 Species:Drosophila melanogaster


Alignment Length:151 Identity:36/151 - (23%)
Similarity:61/151 - (40%) Gaps:31/151 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SHGERKGRLNV--VKFLELGFAVACLVL--------HFYSF-NDRDIMTSFLATGTFTGY--IIV 53
            :||.:|....|  :|.:||...:.||.|        |...| ..|.....::..|..|.|  |.:
  Fly    25 THGNKKATYTVICIKIVELCLLICCLGLIDEPATNSHLRVFITPRVASLCYVTFGALTIYTAIYL 89

  Fly    54 VIGVFAGVLMRAPIHKRIDIFFSVLGCTLFVASGVFIIEAWEFSFRTRTR----------DLALI 108
            ::.:|..:   .|  .|....::::...||||....:...|.   .|:.|          ||.:.
  Fly    90 IMALFGDL---TP--WRTATLWNLVAFVLFVAVTALLFRDWS---TTKDRNYWHPNMHRLDLVMA 146

  Fly   109 KASLSIVNGVLFGFDAVFTFR 129
            .||:::|..::|..|.:.|.|
  Fly   147 SASIALVTSLVFLLDILITLR 167



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR36692
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.