DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and NTF2

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_010925.1 Gene:NTF2 / 856727 SGDID:S000000811 Length:125 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:54/127 - (42%)
Similarity:79/127 - (62%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQ 65
            |||:  :..:.:.|.|.||..||  .:|:.:.|.| ..:|.:|||..|:|||..|:||:.||.||
Yeast     1 MSLD--FNTLAQNFTQFYYNQFD--TDRSQLGNLY-RNESMLTFETSQLQGAKDIVEKLVSLPFQ 60

  Fly    66 KITRVITTVDSQPTF-DGGVLINVLGRLQCDDDP-PHAFSQVFFLKANAGTFFVAHDIFRLN 125
            |:...|||:|:||.. :|.||:.:.|.|..|::. |..|||||.|..:..:::|.:||||||
Yeast    61 KVQHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRLN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 49/120 (41%)
NTF2NP_010925.1 NTF2 4..123 CDD:238403 51/124 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343840
Domainoid 1 1.000 91 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 97 1.000 Inparanoid score I1479
Isobase 1 0.950 - 0 Normalized mean entropy S959
OMA 1 1.010 - - QHG54157
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm46502
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.