DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and AT1G69250

DIOPT Version :10

Sequence 1:NP_608422.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_177085.1 Gene:AT1G69250 / 843256 AraportID:AT1G69250 Length:427 Species:Arabidopsis thaliana


Alignment Length:126 Identity:38/126 - (30%)
Similarity:60/126 - (47%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PQYEDIGKGFVQQYYAIFDD---PANR----ANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSL 62
            |..:||...||:|||.:...   .|.|    |:||:....|.:.|:|     .....|.:.:.|.
plant     8 PSAQDIAAEFVRQYYHVLGQLPHEARRLYVDASVVSRPDVTGTMMSF-----TSVEAINKHILSC 67

  Fly    63 SFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFR 123
            .|:.....:.:||||.:.:.|:.|.|:|.:...|:....|||:|:| |...|..|.:|:.|
plant    68 DFENTKFEVLSVDSQNSLEDGIFIMVIGFMTGKDNQRRKFSQMFYL-ARQNTLVVLNDMLR 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_608422.1 NTF2 6..125 CDD:238403 37/125 (30%)
AT1G69250NP_177085.1 NTF2 9..130 CDD:238403 37/125 (30%)
RRM 281..357 CDD:214636
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.