DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and NTF2A

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_174051.1 Gene:NTF2A / 839620 AraportID:AT1G27310 Length:122 Species:Arabidopsis thaliana


Alignment Length:119 Identity:55/119 - (46%)
Similarity:75/119 - (63%) Gaps:7/119 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQKITRVITTV 74
            :.|.||:.||:.||  |||..:|:.|. ..|.:||||.:|||:..|:.|:..|.||:....||||
plant     6 VAKAFVEHYYSTFD--ANRPGLVSLYQ-EGSMLTFEGQKIQGSQNIVAKLTGLPFQQCKHNITTV 67

  Fly    75 DSQPTFD-GGVLINVLGRLQCDDDPPHA--FSQVFFLKANAGTFFVAHDIFRLN 125
            |.||:.. ||:|:.|.|.||...: .||  |||:|.|.:|.|.::|.:||||||
plant    68 DCQPSGPAGGMLVFVSGNLQLAGE-QHALKFSQMFHLISNQGNYYVFNDIFRLN 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 53/117 (45%)
NTF2ANP_174051.1 NTF2 2..121 CDD:238403 55/119 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 90 1.000 Inparanoid score I2276
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - mtm1079
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.