DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and NTL

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001323167.1 Gene:NTL / 837700 AraportID:AT1G11570 Length:153 Species:Arabidopsis thaliana


Alignment Length:124 Identity:49/124 - (39%)
Similarity:74/124 - (59%) Gaps:9/124 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQKITRVIT 72
            |::...||..||.:||:  :|:::.:.|:.| |.:||||..|.|...|..|::.|.|.:...:|:
plant    31 EEVASAFVNHYYHLFDN--DRSSLSSLYNPT-SLLTFEGQTIYGVDNISNKLKQLPFDQCHHLIS 92

  Fly    73 TVDSQPTF----DGGVLINVLGRLQC-DDDPPHAFSQVFFL-KANAGTFFVAHDIFRLN 125
            ||||||:.    .||:|:.|.|.:|. .:|.|..|||.|.| ....|:|||.:::||||
plant    93 TVDSQPSSMAGGCGGILVFVSGSIQLHGEDHPLRFSQTFHLIPVLQGSFFVQNEMFRLN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 47/122 (39%)
NTLNP_001323167.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 90 1.000 Inparanoid score I2276
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - mtm1079
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.