DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and Nutf2

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001344158.1 Gene:Nutf2 / 68051 MGIID:1915301 Length:127 Species:Mus musculus


Alignment Length:128 Identity:52/128 - (40%)
Similarity:74/128 - (57%) Gaps:3/128 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQ 65
            |...|.:|.||..|:|.||.:||:...:...: :..|  |.:|:||.|.||...|:||:.||.||
Mouse     1 MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAI-YIDA--SCLTWEGQQFQGKAAIVEKLSSLPFQ 62

  Fly    66 KITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFRLNIHN 128
            ||...||..|.|||.|..::..|:|:|:.|:||...|.|:|.||.....:...:|:|||.:||
Mouse    63 KIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 47/118 (40%)
Nutf2NP_001344158.1 NTF2 7..122 CDD:238403 47/117 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837182
Domainoid 1 1.000 91 1.000 Domainoid score I7676
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 99 1.000 Inparanoid score I4989
Isobase 1 0.950 - 0 Normalized mean entropy S959
OMA 1 1.010 - - QHG54157
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm42413
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.