DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and nutf2

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001011126.1 Gene:nutf2 / 496540 XenbaseID:XB-GENE-952887 Length:127 Species:Xenopus tropicalis


Alignment Length:129 Identity:56/129 - (43%)
Similarity:75/129 - (58%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATD-SFMTFEGHQIQGAPKILEKVQSLSF 64
            |:..|.:|.||..|:||||..||  .:|..:...|  || |.:|:||.|..|...|:||:..|.|
 Frog     1 MAEKPIWEQIGSSFIQQYYQTFD--TDRTQLAVIY--TDASCLTWEGQQYHGKAAIVEKLSMLPF 61

  Fly    65 QKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFRLNIHN 128
            |||...||:.|.|||.|..::..|:|:|:.||||...|.|||.||.....:...:|:|||.:||
 Frog    62 QKIQHSITSQDHQPTPDSCIISMVVGQLKADDDPIMGFHQVFLLKNIQDAWVCTNDMFRLALHN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 51/119 (43%)
nutf2NP_001011126.1 NTF2 7..122 CDD:238403 51/118 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7733
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 97 1.000 Inparanoid score I4896
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm47522
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.