DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and nutf2l

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001003598.1 Gene:nutf2l / 445204 ZFINID:ZDB-GENE-020416-1 Length:128 Species:Danio rerio


Alignment Length:129 Identity:54/129 - (41%)
Similarity:71/129 - (55%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATD-SFMTFEGHQIQGAPKILEKVQSLSF 64
            |:..|.:|.||.||||.||..||  .:|..:.:.|  || |.:|:||...||...|:.|:.||.|
Zfish     1 MAEKPIWEQIGSGFVQHYYHQFD--TDRVKLADLY--TDASCLTWEGEGFQGKNAIMTKLNSLPF 61

  Fly    65 QKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFRLNIHN 128
            |.|...||..|..||.|..|:..|:|:|:.|.|....|.|||.||.....:...:|:|||.:||
Zfish    62 QTIQHSITAQDHHPTPDNCVMSMVMGQLKADQDQVMGFQQVFLLKNLDNKWVCTNDMFRLALHN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 49/119 (41%)
nutf2lNP_001003598.1 NTF2 7..122 CDD:238403 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580762
Domainoid 1 1.000 90 1.000 Domainoid score I7755
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I5015
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - mtm6543
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.