DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and nxt2

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001342808.1 Gene:nxt2 / 2542783 PomBaseID:SPAC15F9.03c Length:123 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:48/121 - (39%)
Similarity:74/121 - (61%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQKITRVI 71
            |..:...|.|.||..||  ::|:.:.:.| ..:|.::|||.|:||...|:||:.||.||::...|
pombe     4 YNALATQFTQFYYQTFD--SDRSQLSSLY-REESMLSFEGAQLQGTKAIVEKLVSLPFQRVQHRI 65

  Fly    72 TTVDSQPT-FDGGVLINVLGRLQCDDDP-PHAFSQVFFLKANAGTFFVAHDIFRLN 125
            :|:|:||| ..|.|::.|.|.|..|::. ...:||||.|..|.|.::|.:|:||||
pombe    66 STLDAQPTGTTGSVIVMVTGELLLDEEQMAQRYSQVFHLVNNNGNYYVLNDLFRLN 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 46/119 (39%)
nxt2NP_001342808.1 NTF2 3..122 CDD:238403 48/121 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2307
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 86 1.000 Inparanoid score I1790
OMA 1 1.010 - - QHG54157
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm46997
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.