DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and Nxt2

DIOPT Version :10

Sequence 1:NP_608422.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001277461.1 Gene:Nxt2 / 237082 MGIID:2147914 Length:198 Species:Mus musculus


Alignment Length:125 Identity:35/125 - (28%)
Similarity:52/125 - (41%) Gaps:25/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FVQQYYAIFDDPANRANVVNFY--SATDSFMTFEGHQIQGAPKI---LEKVQSLSFQKITRVITT 73
            ||..||...|  ..|..:|..|  .||   :.:.|:.:.|...:   .|.:.|..||     |..
Mouse    77 FVNIYYETMD--KRRHALVRLYLDKAT---LIWNGNVVTGLEALANFFEMLPSSEFQ-----INM 131

  Fly    74 VDSQPTFDGG------VLINVLGRLQCDDDPPHAFSQVFFLKA----NAGTFFVAHDIFR 123
            :|.||..:..      ||:...|.::.|.:..|.|:|.|.|.|    |:..:.:|.|.||
Mouse   132 LDCQPVHEQATQCQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQSTPNSTVWKIASDCFR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_608422.1 NTF2 6..125 CDD:238403 35/125 (28%)
Nxt2NP_001277461.1 NTF2 69..194 CDD:238403 35/125 (28%)

Return to query results.
Submit another query.