DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2 and ran-4

DIOPT Version :9

Sequence 1:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_492322.1 Gene:ran-4 / 172648 WormBaseID:WBGene00004305 Length:133 Species:Caenorhabditis elegans


Alignment Length:133 Identity:63/133 - (47%)
Similarity:91/133 - (68%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNPQYEDIGKGFVQQYYAIFD--DPANRA-NVVNFYSATDSFMTFEGHQIQGAPKILEKVQSL 62
            ||.||.||.:.|.|:|.||:.||  |..:|| .:.:.|...:|:|||||.|.:|...||:|..:|
 Worm     1 MSFNPDYESVAKAFIQHYYSKFDVGDGMSRAQGLSDLYDPENSYMTFEGQQAKGRDGILQKFTTL 65

  Fly    63 SFQKITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKA-NAGTFFVAHDIFRLNI 126
            .|.||.|.||.:||||.:||.:.:.|||:|:.|:||.:.|||||.|:. |.|::|:.::||||::
 Worm    66 GFTKIQRAITVIDSQPLYDGSIQVMVLGQLKTDEDPINPFSQVFILRPNNQGSYFIGNEIFRLDL 130

  Fly   127 HNS 129
            ||:
 Worm   131 HNN 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 56/122 (46%)
ran-4NP_492322.1 NTF2 6..128 CDD:238403 55/121 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159384
Domainoid 1 1.000 111 1.000 Domainoid score I3914
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 128 1.000 Inparanoid score I3240
Isobase 1 0.950 - 0 Normalized mean entropy S959
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm14246
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R846
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1716.790

Return to query results.
Submit another query.