DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG4730

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:447 Identity:105/447 - (23%)
Similarity:165/447 - (36%) Gaps:133/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTFTDLARLCRICLRHLRDRDTHCPDPRLIAILQKLLDI----------------------DILK 45
            ||..:|:..||:||..        |.|      .::||:                      |:.:
  Fly    38 TTSLELSNCCRLCLEE--------PYP------NQMLDMTVIYDQEAALSYYDCYEICTKEDLRQ 88

  Fly    46 QPHGFPTEICNLCHNAVVYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEH 110
            .|...|..:|..|...:.:..:..:....::|:|   :.:.:|.:...|:..|    ...||||.
  Fly    89 NPKNEPRTLCKRCAVELKWAYDFHKKMAIANQQL---REIFVATEANTEQEDD----VEDEENEA 146

  Fly   111 ELEEEHEKQADGQQVDLSKKQEDQKKILDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCG 175
            ::.||...:      ::.:|||..   :|..||                                
  Fly   147 DMNEEFLME------EIEEKQETP---IDSLED-------------------------------- 170

  Fly   176 KQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELC 240
                .:|      |:.|.|.|.   |:.|.|.|      |:|.|.|..|:..|... .:..|..|
  Fly   171 ----IVP------RNRHTGKSN---CKFCHKEF------RNHSRMAKHQMIHLANR-PNFRCSQC 215

  Fly   241 NRQYSTKNALGEHL-KRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHK 304
            :|.|.||.||..|: .:|.|...| |:.||........|..|.|.||..:. :.|:.|.:.|..:
  Fly   216 DRVYLTKQALKVHVDSKHRQSGVH-CDTCGKVFAIAKALEIHKRYHNRDFP-YSCDLCDRRFAQR 278

  Fly   305 SAISRHVRVVHEGQRRFQCGH--CEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHCQKPC 367
            |.::.|.:|.|.|. ||.|..  |:|.|.:.:|...||..||          ..||.|.||.:..
  Fly   279 SHLTVHQQVKHSGS-RFICEFPGCQKSFTSSSSLRNHECTHT----------AMPFECAHCHQSY 332

  Fly   368 VSRQTLELHL-RRH----------RARKTH--RKRREHSRESQEQEQEHDRDQEQGA 411
            .:|..|.:|| |:|          ..||.|  |.:...::...:|::.|....:..|
  Fly   333 PARNKLRMHLERKHNMVVQMEDLEEMRKFHIVRSKLVMAKIYSDQKESHHAKNDSAA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 14/89 (16%)
C2H2 Zn finger 171..192 CDD:275368 2/20 (10%)
zf-C2H2_2 201..>257 CDD:289522 19/56 (34%)
C2H2 Zn finger 201..222 CDD:275368 7/20 (35%)
C2H2 Zn finger 237..257 CDD:275368 9/20 (45%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 26/82 (32%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 7/21 (33%)
C2H2 Zn finger 360..380 CDD:275368 8/20 (40%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 15/94 (16%)
C2H2 Zn finger 183..203 CDD:275368 9/25 (36%)
C2H2 Zn finger 212..232 CDD:275368 9/19 (47%)
C2H2 Zn finger 240..260 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..289 CDD:275368 6/20 (30%)
C2H2 Zn finger 296..318 CDD:275368 7/21 (33%)
C2H2 Zn finger 325..346 CDD:275368 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.