DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG6791

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:570 Identity:101/570 - (17%)
Similarity:170/570 - (29%) Gaps:217/570 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FTTFTDLARLCRICLRH---------LRDRDTHCPDPRLIAILQKLLDIDILKQPHGFPTEICNL 57
            ||....|.:.||.|.:.         |:.:.||.|        .:.....|.|:.:.:..::  :
  Fly   198 FTPLDKLYQRCRECNKRIAMHSRENLLKHKFTHLP--------FRCTKCYICKREYKYRQDL--M 252

  Fly    58 CHNAVVYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEHELEEEHEKQADG 122
            .|..:|:.||:..:.||      |:.... ...||:|...::.|:|.......:|.||       
  Fly   253 VHLRMVHCDEVVAMMRE------GYNAAG-RKTRVRESRTEQLLREKSFRENDDLGEE------- 303

  Fly   123 QQVDLSKKQEDQKKILDDREDEEYPDEYENSQQQLSQGTGSKRRAGLA-------CDQCGKQVYK 180
                 |.:.|.:.::|:...||....|...|::...:..|::..|.|.       |..||.....
  Fly   304 -----SDRIEVRNELLEPDADESGTQEQTVSEEVSKKKAGTRGAAELCEDYIHYMCPDCGTDCDT 363

  Fly   181 LPYLEAHIRSVHQGYSKPFL----------CRSCDKSFT--RYEQLRSHMRNAHPQLEQLQQELR 233
            ......||..||...|:..|          |..|.|..|  ..:.||:|..:...|.|.|:    
  Fly   364 HAQWSQHIEFVHDYVSRRGLNFRSVDMQMQCLECKKIVTPNTIKSLRAHKFSHLSQPEWLR---- 424

  Fly   234 DLICELCNRQYSTKNALGEH-LKRH---------------------------------------- 257
               |:||.:.|:....:..| |::|                                        
  Fly   425 ---CKLCYKGYTDHQEIIRHLLQQHHMDTLMSEDAEEEDGDAPSAIEDECDGDNGNGEGNGAPLD 486

  Fly   258 --------AQRK--------------EHVCEHCGVAKVTRTELLTHL------------------ 282
                    |.|:              :::|..||...:.:....||:                  
  Fly   487 EDSPYFEDAPRRGGRISSDDIFEPHIDYLCPQCGKEFIEKKHWRTHVVMAHSMNDLSKLNFEMIN 551

  Fly   283 --------------------------RTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHE-GQRR 320
                                      .||.|.....:|.:|.:.:..:..:.:|:...|. |..|
  Fly   552 ERQLKCTECDKIITNAYGIQNAQQHRITHLPFKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPR 616

  Fly   321 FQCGHCEKKFGTHASQVR----------HERLHTESTGSGEAAE-------------EWPFA--- 359
            ...|.|.....|.|.|.|          :|.::.:....|...|             |:|.|   
  Fly   617 KLSGGCPAPILTPAKQPRKQIVTVANETYEIIYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPP 681

  Fly   360 -------------------CIHCQKPCVSRQTLELHLRRHRARKTHRKRR 390
                               |:||.....::..:.:|:...|.|||..:||
  Fly   682 PSPPPPPQPTTQGNHQRYKCVHCGTLFATQAAVRVHISEKRCRKTVVRRR 731

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 15/76 (20%)
C2H2 Zn finger 171..192 CDD:275368 5/20 (25%)
zf-C2H2_2 201..>257 CDD:289522 16/58 (28%)
C2H2 Zn finger 201..222 CDD:275368 7/22 (32%)
C2H2 Zn finger 237..257 CDD:275368 6/20 (30%)
C2H2 Zn finger 265..285 CDD:275368 5/63 (8%)
zf-C2H2_8 268..349 CDD:292531 20/135 (15%)
C2H2 Zn finger 294..315 CDD:275368 3/20 (15%)
C2H2 Zn finger 323..343 CDD:275368 7/29 (24%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368 4/21 (19%)
C2H2 Zn finger 235..256 CDD:275368 3/22 (14%)
C2H2 Zn finger 516..532 CDD:275368 3/15 (20%)
C2H2 Zn finger 557..580 CDD:275368 0/22 (0%)
C2H2 Zn finger 589..609 CDD:275368 3/19 (16%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.