DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG2678

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_649750.1 Gene:CG2678 / 40937 FlyBaseID:FBgn0014931 Length:434 Species:Drosophila melanogaster


Alignment Length:497 Identity:106/497 - (21%)
Similarity:161/497 - (32%) Gaps:190/497 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCRICL----------RHLRDRDTHCPDPRLIAILQKLLDIDILKQPHGFPTEICNLCHNAVVYF 65
            :||.|:          .::||.....|:..|..||.:..:..: |:....|..||..|..||...
  Fly     8 VCRTCMDETGTLVDIFANVRDPVLDEPEMSLSHILARCTERPV-KRGDLLPQFICVSCVLAVQNA 71

  Fly    66 DELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENH--------EENE---HELEEEHEKQ 119
            ...:..:.:|.|...          ||..:   .|..||.        ::|:   .:::.:.::|
  Fly    72 FRFKWQSEQSYQHFF----------RVLNQ---SGAPENQVHLAACNGDKNQIINQKMQLKSDRQ 123

  Fly   120 ADGQQV--------DLSKKQEDQKKILDDREDEEYPDEY------------ENSQQQLSQGTGSK 164
            .|.||:        |||:||..|.|:.:...|.. |:.:            |.:.....:.|.|.
  Fly   124 QDTQQMTKTQKPDDDLSQKQTLQAKLQEGNIDGP-PESFTLHPRKRTCRTEEQADMIPKEATRST 187

  Fly   165 RRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQ 229
            :   :.||.                   .||   :.|..|.|.|....|||:|            
  Fly   188 K---MICDA-------------------DGY---YNCPHCSKRFCSQTQLRTH------------ 215

  Fly   230 QELRDLI--CELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHN------ 286
              :.||.  |..|.|.|..|:.|..||:.|..:..|.|.||..|.:.:..|..|||||:      
  Fly   216 --ITDLCNRCPYCPRTYMQKSNLKRHLRNHLSKPAHKCFHCSKAFMRKDHLKRHLRTHDSDGPLS 278

  Fly   287 ------------------------------------------------PTWER--FK-------- 293
                                                            |.|.:  |.        
  Fly   279 CSQCSAVFIEHVQLEIHRREHKQRPGSSKSESTKDPDSDDSDQAQDLKPKWTKNTFNGTCSIPPM 343

  Fly   294 ------CEQCPQLFRHKSAISRHVRVVHEGQRRF-QCGHCEKKFGTHASQVRHERLHTESTGSGE 351
                  |:.|.:.|....|:.||: :.|..|... :|.:|.::|.|.....||||.|     .|:
  Fly   344 LKPKPICDICQKKFSSVYALKRHM-LTHNRQHHLKKCTYCSEEFKTEKHLKRHERGH-----MGD 402

  Fly   352 AAEEWPFACIHCQKPCVSRQTLELHLRRHRARKTHRKRREHS 393
            .     |.|..|....|...    :||:|       |:|.||
  Fly   403 L-----FRCEFCSLVFVDVN----YLRKH-------KKRIHS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 18/77 (23%)
C2H2 Zn finger 171..192 CDD:275368 2/20 (10%)
zf-C2H2_2 201..>257 CDD:289522 18/57 (32%)
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 265..285 CDD:275368 8/19 (42%)
zf-C2H2_8 268..349 CDD:292531 28/151 (19%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
CG2678NP_649750.1 zf-AD 8..85 CDD:214871 18/77 (23%)
COG5048 220..>284 CDD:227381 20/63 (32%)
C2H2 Zn finger 223..243 CDD:275368 8/19 (42%)
zf-C2H2 249..271 CDD:278523 9/21 (43%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
C2H2 Zn finger 279..299 CDD:275368 0/19 (0%)
C2H2 Zn finger 350..370 CDD:275368 6/20 (30%)
C2H2 Zn finger 379..399 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..427 CDD:275368 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.