DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG1024

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:433 Identity:86/433 - (19%)
Similarity:147/433 - (33%) Gaps:147/433 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILQK-LLDIDI-----------LKQPHGFPTEICNL-------CHNAVVYFDELRQVARESSQKL 79
            :||| |:|||:           |..|...|..|.|:       |.||  |.|.:|:..:|...| 
  Fly   181 LLQKALMDIDLNTEMEKSPVTALAAPVNEPKPISNVSELNLDRCLNA--YEDIVRKEEKEVVPK- 242

  Fly    80 IGWQPVDIAVDRVKEEPPDEGLKENH-EENEHELEEEHEKQADGQQV------DLSKKQEDQKKI 137
                 .|..:|.:.:|..|:|..... |.||.:.:::...|...|:|      .|.|::..|.| 
  Fly   243 -----YDDELDALCKEFFDDGPSAGKGEANEEQQQDDAHLQQGNQEVVIIEIDALGKEEVAQLK- 301

  Fly   138 LDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSK--PFL 200
                        .|.....:||.|  |||          ::...|..::.......|.:|  .:|
  Fly   302 ------------KEMKSDPISQPT--KRR----------RISTTPSRDSDTEMSTNGLTKLISYL 342

  Fly   201 CRSCDKSFTRYEQLRSHMRNAHPQLEQLQQEL------RDLICELCNRQYST--KNALGEHLKRH 257
            |..|.|.....:..|:|:...|.....::...      |..:|..|.....|  ::.|.:|..:|
  Fly   343 CPKCGKEIASMDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKH 407

  Fly   258 AQRKEHV-CEHCGVAKVTRTELLTHLRTHN-----------------PTW--------------- 289
            ...:.:: |..|...|.:.:::|.|:|.::                 |.|               
  Fly   408 LPYRSYLKCTLCDRTKTSTSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDA 472

  Fly   290 -------ERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTEST 347
                   |:..||.|.::||.|....||:            ..|.:                  :
  Fly   473 GSEDDQGEQAVCEHCDRVFRSKWRYERHI------------ASCRR------------------S 507

  Fly   348 GSGEAAEEWPFACIHCQKPCVSRQTLELHLRRHRARKTHRKRR 390
            |:|::.|....|.::        ...|.|:|.:...||.::.:
  Fly   508 GAGKSVEGTVEALLN--------HLREGHMRMNAIWKTMQREK 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 19/63 (30%)
C2H2 Zn finger 171..192 CDD:275368 1/20 (5%)
zf-C2H2_2 201..>257 CDD:289522 12/63 (19%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 5/21 (24%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 17/119 (14%)
C2H2 Zn finger 294..315 CDD:275368 8/20 (40%)
C2H2 Zn finger 323..343 CDD:275368 1/19 (5%)
C2H2 Zn finger 360..380 CDD:275368 3/19 (16%)
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.