DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and Blimp-1

DIOPT Version :10

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:349 Identity:87/349 - (24%)
Similarity:122/349 - (34%) Gaps:97/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 CDQCGKQVYKLPYLEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDL 235
            |:.|.|...:|..|:.|:|: |.| .:||.|..|.||||:...|:.|                  
  Fly   892 CNVCCKTFGQLSNLKVHLRT-HSG-ERPFKCNVCTKSFTQLAHLQKH------------------ 936

  Fly   236 ICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQL 300
                             ||. |...|.|.|:.|.....:.:.|.||||.|:.. :.:.|:.|||.
  Fly   937 -----------------HLV-HTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQ-KPYACDLCPQK 982

  Fly   301 FRHKSAISRHVRVVHEGQRRFQCGHCEKKF------GTH--ASQVRHERLHTESTGSGEAAEEWP 357
            |.....:..|.| :|...|.:.|..|:||:      .||  .:..:...|..|...:..|..|  
  Fly   983 FTQFVHLKLHKR-LHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPNNLEEELAMAAAATSE-- 1044

  Fly   358 FACIHCQKP-CVSRQTLELHLRRHRARKTHRKRREHSRESQEQEQ-----EHDRDQEQGAREAQQ 416
              |:....| ..||:..| .|.:|.....|...|..|...|...:     .|...|:|..::.||
  Fly  1045 --CLDKDHPEPDSREAYE-QLTQHMHPAVHPGLRHLSSGGQSPPRLIPLGNHMAPQQQSHQQQQQ 1106

  Fly   417 DQLRKGEKLRQRDLSRESHRNEVTMQTSQRPNECQQGQESYDPEPDPL-EASQCKLEQEDALDPE 480
            ...::|..                      |......|.|..|.|..| .|||        |.|.
  Fly  1107 QHQQQGVP----------------------PPHLLMTQHSVGPAPMLLTTASQ--------LPPP 1141

  Fly   481 WQHKIEQDAESQDSARL--EGHFH 502
            ..|. :|::.|    ||  .||.|
  Fly  1142 PPHH-QQNSPS----RLLQHGHAH 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:462262
C2H2 Zn finger 171..192 CDD:275368 7/20 (35%)
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 237..257 CDD:275368 2/19 (11%)
C2H2 Zn finger 265..285 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 6/27 (22%)
C2H2 Zn finger 360..380 CDD:275368 6/20 (30%)
tolA 391..>495 CDD:236545 22/109 (20%)
Blimp-1NP_001261442.1 PR-SET_PRDM1 120..262 CDD:380964
zf-C2HE <871..912 CDD:465082 7/20 (35%)
C2H2 Zn finger 892..912 CDD:275368 7/20 (35%)
zf-H2C2_2 904..929 CDD:463886 12/26 (46%)
C2H2 Zn finger 920..940 CDD:275368 10/55 (18%)
SFP1 <938..1020 CDD:227516 25/84 (30%)
C2H2 Zn finger 948..968 CDD:275368 7/19 (37%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.