DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and scrt

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:153 Identity:41/153 - (26%)
Similarity:70/153 - (45%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQGYSKPFL--CRSCDKSFTRYEQLRSHMRNAHP 223
            |..:::....|.:||||......|..| :..|:.......  |.:|.|::.....|..|:     
  Fly   459 TPDQQKTKYTCSECGKQYATSSNLSRH-KQTHRSLDSQSAKKCHTCGKAYVSMPALAMHL----- 517

  Fly   224 QLEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPT 288
                |..:|.. .|.:|.:.:|....|..||:.|...|.:.|.|||.|...|:.|..|::||:..
  Fly   518 ----LTHKLSH-SCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVD 577

  Fly   289 WERFKCEQCPQLFRHKSAISRHV 311
             :.|:|::|.:.|..||.:::|:
  Fly   578 -KNFECKRCHKTFALKSYLNKHL 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 7/20 (35%)
zf-C2H2_2 201..>257 CDD:289522 13/55 (24%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 8/19 (42%)
zf-C2H2_8 268..349 CDD:292531 15/44 (34%)
C2H2 Zn finger 294..315 CDD:275368 6/18 (33%)
C2H2 Zn finger 323..343 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 7/22 (32%)
C2H2 Zn finger 469..489 CDD:275370 7/20 (35%)
C2H2 Zn finger 500..520 CDD:275368 6/28 (21%)
COG5048 520..>617 CDD:227381 26/82 (32%)
C2H2 Zn finger 526..546 CDD:275368 6/19 (32%)
zf-H2C2_2 539..562 CDD:290200 10/22 (45%)
C2H2 Zn finger 554..574 CDD:275368 8/19 (42%)
zf-C2H2 554..574 CDD:278523 8/19 (42%)
zf-H2C2_2 566..590 CDD:290200 7/24 (29%)
C2H2 Zn finger 582..599 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.