DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG12605

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001261387.1 Gene:CG12605 / 38468 FlyBaseID:FBgn0035481 Length:619 Species:Drosophila melanogaster


Alignment Length:252 Identity:63/252 - (25%)
Similarity:102/252 - (40%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VDIAVDRVKEEPPDEGLKENHEENEH---------ELEEEHEKQADGQQVDLSKKQEDQKKILDD 140
            |||.:....|....:..|.|.::|:.         .:.:...|.:....|....:||..:.....
  Fly   333 VDIDMSSSSESGLQQWGKPNPQQNQQRASALKMCLNMLDGRTKASKAAAVTKQDRQEPMQPRPKS 397

  Fly   141 RED---------EEYPDEYENSQQQLSQGTG---SKRRAG-LACDQCGKQVYKLPYLEAH---IR 189
            .:.         .|.|:....|....|.|.|   :||:.| ..|.:||||......|..|   .|
  Fly   398 AQSNASSGGGPPSEPPENPAASLGHSSSGNGENYAKRKRGCYKCCECGKQYATSSNLSRHKQTHR 462

  Fly   190 SVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHL 254
            |:....:|.  |.:|.|::.....|..|:         |..:|.. .|::|.:.:|....|..||
  Fly   463 SLDSQSAKK--CNTCGKAYVSMPALAMHL---------LTHKLSH-SCDICGKLFSRPWLLQGHL 515

  Fly   255 KRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHV 311
            :.|...|.:.|.|||.|...|:.|..|::||:.. :.|||.:|.:.|..||.:::|:
  Fly   516 RSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGD-KNFKCHRCNKTFALKSYLNKHL 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 9/23 (39%)
zf-C2H2_2 201..>257 CDD:289522 13/55 (24%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 8/19 (42%)
zf-C2H2_8 268..349 CDD:292531 16/44 (36%)
C2H2 Zn finger 294..315 CDD:275368 6/18 (33%)
C2H2 Zn finger 323..343 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
CG12605NP_001261387.1 zf-C2H2 439..461 CDD:278523 7/21 (33%)
C2H2 Zn finger 441..461 CDD:275370 7/19 (37%)
C2H2 Zn finger 472..492 CDD:275368 6/28 (21%)
COG5048 492..>570 CDD:227381 26/79 (33%)
zf-C2H2 496..518 CDD:278523 6/22 (27%)
C2H2 Zn finger 498..518 CDD:275368 6/19 (32%)
zf-H2C2_2 511..534 CDD:290200 10/22 (45%)
zf-C2H2 524..546 CDD:278523 8/21 (38%)
C2H2 Zn finger 526..546 CDD:275368 8/19 (42%)
zf-H2C2_2 538..562 CDD:290200 8/24 (33%)
C2H2 Zn finger 554..571 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.