DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and Kah

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:81/208 - (38%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 CRSCDKSFTRYEQ-------LRSHMRNAHPQLEQ---------LQQELRDLICELCNRQYSTKNA 249
            |.|...|.|...|       |:.|....|...||         |:.|   .||..|.::|||.:.
  Fly    72 CASSSSSSTSSRQSSEDHLGLQGHSSVHHHHGEQGEILNSTSLLEDE---HICPECGKKYSTSSN 133

  Fly   250 LGEHLKRH---AQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHV 311
            |..|.:.|   ..:|...|.:|....|:......|:||||...|   |:.|.:.|.....:..|:
  Fly   134 LARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHNQGCE---CQFCGKRFSRPWLLQGHI 195

  Fly   312 RVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHCQKPCVSRQTLELH 376
            | .|.|::.|:||.|||.|...::...|.:.|:.:.         |..|..|.|..    .|:.:
  Fly   196 R-THTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTK---------PHTCARCGKAF----ALKSY 246

  Fly   377 LRRHRARKTHRKR 389
            |.:|......:.|
  Fly   247 LYKHEESSCMKNR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368
zf-C2H2_2 201..>257 CDD:289522 20/71 (28%)
C2H2 Zn finger 201..222 CDD:275368 7/27 (26%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 5/19 (26%)
zf-C2H2_8 268..349 CDD:292531 24/80 (30%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 8/21 (38%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 6/25 (24%)
C2H2 Zn finger 178..198 CDD:275368 5/20 (25%)
zf-H2C2_2 191..214 CDD:290200 10/23 (43%)
zf-C2H2 204..226 CDD:278523 8/21 (38%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 6/36 (17%)
C2H2 Zn finger 234..250 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.