DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG31612

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001163042.1 Gene:CG31612 / 35427 FlyBaseID:FBgn0051612 Length:987 Species:Drosophila melanogaster


Alignment Length:470 Identity:96/470 - (20%)
Similarity:156/470 - (33%) Gaps:165/470 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KQPHGFPTEICNLCHNAVVYFDELRQVARESSQKLIGWQPVDIAVDRVKEEPPDEGLKENHEENE 109
            |..|......|.:|.   :.||......|..|          :.:.:.|.. |...:.:...|.|
  Fly   550 KHKHHLARYFCAICR---LEFDNSLDARRHRS----------LVIHKQKAR-PQTSIPQPENEIE 600

  Fly   110 HELEEEHEKQADG----QQVDLSKKQEDQKKILDDRED-EEYPDEYENSQQQLSQGTG------- 162
            |.|.|..|:....    :..|::.|..:.:|.::..:. .::..|..:|...|....|       
  Fly   601 HMLREVLEETVPSPPAKRSADVNAKCSNSRKTIESSQRLAQHQAEVHSSDNHLCLSCGISFESAQ 665

  Fly   163 -----------------------SKRRAGLACDQC-----------------------GK-QVYK 180
                                   :::::..:||||                       || :|.:
  Fly   666 ALGRHTRSCQPLASTSTPADLSQAQKKSMYSCDQCRFQSQYESDLVYHRIFHTRSGTIGKNEVLQ 730

  Fly   181 LPY---------LEAHIRSVHQGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQ------------ 224
            .|.         |.||:|: |.. .|.|.|..|.:.|.|...|::|:...|.:            
  Fly   731 CPLCPKNFKKHSLRAHLRN-HTN-EKIFECTECLQKFARRHNLKNHVITKHAKVGDKEKKKYAAK 793

  Fly   225 -LEQLQQEL---------------------------RDLICELCNRQYS--TKNALGEHLKRHAQ 259
             :||.:.:.                           |:.:|...:..|:  |..:|..||..|:|
  Fly   794 DVEQSKPKYQCGTCGKLLAKKYSLKLHEISHSKAVERNYLCHFADCSYAGRTPESLKTHLVSHSQ 858

  Fly   260 RKEHVCEHCGVAKVTRTELLTHLRTH----------NPTWERFKCEQCPQLFRHKSAISRHVRVV 314
             :.|.|.....:.|.::||  ||:.|          ...|  |.|:||....|.|..:.|| .:.
  Fly   859 -ENHKCARINCSYVGKSEL--HLKRHLKSAHSTEKNGEEW--FSCDQCDFRARIKGHLRRH-SLR 917

  Fly   315 HEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACI-HCQKPCVSRQTLEL--- 375
            |.||:..||.||:    ...|.:.:.|.|...||      :.|...| ||.| |...:..|:   
  Fly   918 HSGQKPHQCPHCD----FQCSTIDNLRKHIIKTG------KHPGMFIYHCAK-CSDEEAGEIFKS 971

  Fly   376 --------HLRRHRA 382
                    ||:.|:|
  Fly   972 NSYKEYQHHLKTHKA 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 8/33 (24%)
C2H2 Zn finger 171..192 CDD:275368 12/53 (23%)
zf-C2H2_2 201..>257 CDD:289522 16/97 (16%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 6/21 (29%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 26/90 (29%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
C2H2 Zn finger 360..380 CDD:275368 8/31 (26%)
CG31612NP_001163042.1 C2H2 Zn finger 697..717 CDD:275368 4/19 (21%)
C2H2 Zn finger 731..750 CDD:275368 5/19 (26%)
C2H2 Zn finger 758..779 CDD:275368 6/20 (30%)
C2H2 Zn finger 804..824 CDD:275368 0/19 (0%)
C2H2 Zn finger 834..856 CDD:275368 6/21 (29%)
C2H2 Zn finger 898..918 CDD:275368 7/20 (35%)
zf-H2C2_2 910..935 CDD:290200 9/29 (31%)
C2H2 Zn finger 926..945 CDD:275368 6/22 (27%)
C2H2 Zn finger 957..984 CDD:275368 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.