DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and Plzf

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:368 Identity:81/368 - (22%)
Similarity:146/368 - (39%) Gaps:81/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CNLCHNAVV--YFDELRQVARESS---QKLIGWQPVDIAVDRVKEEPPDEGLKENHEENEHELEE 114
            |..|.:.:|  ::::|..|::|..   ::|.....|...::..:.:|..|.            :|
  Fly    87 CTQCLHTIVDFFYEDLVSVSKEHELHFRELAQILAVTELLNLYQLQPLGEA------------KE 139

  Fly   115 EHEKQADGQ---QVDLSKKQEDQKKILDDREDEEYPDEYENSQQQLSQGTGSKRRAGLACDQCGK 176
            ..|..|.|:   ..|..||.|   .:.::|:      .|...:...:..:.||....:.||....
  Fly   140 ATEIPAPGEAQPNPDPEKKAE---AVFENRQ------SYFKLKNPRAVKSSSKVNYCIGCDFKCY 195

  Fly   177 QVYKLPYLEAHIRSVHQGYSKP--FLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICEL 239
            ||.|:  :|      |.|..:|  .:|..|:..|..:.:..:|:|.....|.      :...|..
  Fly   196 QVQKM--IE------HMGSCEPSHLICSLCEVGFLDWREYDTHLRRHSGDLR------KPFFCLQ 246

  Fly   240 CNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHK 304
            |..:::|:.||..|..:|:....|:|.|||.....:..|..|:..|||. ::..|:.|.....|.
  Fly   247 CGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHNPE-KQMLCDVCGYSTTHM 310

  Fly   305 SAISRHVRVVHEGQRRFQC--GHCEKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHCQKPC 367
            .|:..| :::|.|: .|.|  ..|:.:    |::..:.:||.|:...|.     .|.|    :.|
  Fly   311 KALKSH-KLLHTGE-FFACTVSGCKHR----ANRKENLKLHIETHKQGR-----DFIC----EVC 360

  Fly   368 VSRQTLELHLRRHRARKT----------------HR--KRREH 392
            ..:.:...:|:||..:.|                ||  |.:||
  Fly   361 GCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 6/28 (21%)
C2H2 Zn finger 171..192 CDD:275368 6/20 (30%)
zf-C2H2_2 201..>257 CDD:289522 12/55 (22%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 21/82 (26%)
C2H2 Zn finger 294..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 323..343 CDD:275368 3/21 (14%)
C2H2 Zn finger 360..380 CDD:275368 3/19 (16%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 55/239 (23%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 6/19 (32%)
C2H2 Zn finger 300..320 CDD:275368 5/20 (25%)
C2H2 Zn finger 330..349 CDD:275368 5/22 (23%)
C2H2 Zn finger 357..377 CDD:275368 5/23 (22%)
C2H2 Zn finger 387..408 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.